Obtustatin

Pricing Availability   Qty

Save 26% on Select RUO Reagents. See Details

Description: Potent and selective α1β1 inhibitor
Purity: ≥95% (HPLC)
Datasheet
Citations (5)
Reviews (1)
Literature (2)

Biological Activity for Obtustatin

Obtustatin is a highly potent integrin α1β1 inhibitor (IC50 = 0.8 nM for α1β1 binding to type IV collagen). Selective for α1β1 over α2β1, αIIbβ3, αvβ3, α4β1, α5β6, α9β1 and α4β7. Inhibits FGF2-stimulated angiogenesis in the chicken chorioallantoic model. Displays antitumor efficacy in a synergistic mouse model of Lewis lung carcinoma; blocks human melanoma growth in nude mice.

Technical Data for Obtustatin

M. Wt 4393.07
Formula C184H284N52O57S8
Sequence CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG

(Modifications: Disulfide bridges: 1-10, 6-29, 7-34, 19-36)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 404882-00-4
PubChem ID 90488962
InChI Key XXWNADNJWWLFFP-UHFFFAOYSA-N
Smiles [H]N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]3CSSC[C@@H]4NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CSSC[C@H](NC(=O)[C@@H]5CCCN5C(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC1=O)[C@@H](C)O)[C@@H](C)O)C(=O)N3)NC(=O)[C@H](CC1=CC=C(O)C=C1)NC(=O)[C@H](CC1=CNC=N1)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC1=CNC3=C1C=CC=C3)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CC(O)=O)NC4=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC2=O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for Obtustatin

Solubility Soluble to 1 mg/ml in water

Product Datasheets for Obtustatin

Certificate of Analysis / Product Datasheet
Select another batch:

References for Obtustatin

References are publications that support the biological activity of the product.

Moreno-Murciano et al (2003) Amino acid sequence and homology modeling of obtustatin, a novel non-RGD-containing short disintegrin isolated from the venom of Vipera lebetina obtusa. Protein Sci. 12 366 PMID: 12538900

Marcinkiewicz et al (2003) Obtustatin: a potent and selective inhibitor of α1β1 integrin in vitro and angiogenesis in vivo. Cancer Res. 63 2020 PMID: 12727812

Brown et al (2008) Angiostatic activity of obtustatin as α1β1 integrin inhibitor in experimental melanoma growth. Int.J.Cancer 123 2195 PMID: 18712720


If you know of a relevant reference for Obtustatin, please let us know.

View Related Products by Product Action

View all Integrin Inhibitors

Keywords: Obtustatin, Obtustatin supplier, integrins, alpha1beta1, a1b1, aαnβ, potent, selective, inhibitors, inhibits, antiangiogenics, angiogenesis, Integrins, Cell, Adhesion, Molecules, Antiangiogenics, 4664, Tocris Bioscience

5 Citations for Obtustatin

Citations are publications that use Tocris products. Selected citations for Obtustatin include:

Elsa et al (2019) The antitumor efficacy of monomeric disintegrin obtustatin in S-180 sarcoma mouse model. Invest New Drugs 37 1044-1051 PMID: 30680583

Elaine T et al (2021) Collagen I Fibrous Substrates Modulate the Proliferation and Secretome of Estrogen Receptor-Positive Breast Tumor Cells in a Hormone-Restricted Microenvironment. ACS Biomater Sci Eng 7 2430-2443 PMID: 33688723

Hanna et al (2017) Modulation of interactions of neuroblastoma cell lines with extracellular matrix proteins affects their sensitivity to treatment with the anti-GD2 ganglioside antibody 14G2a. Int J Oncol 50 1899-1914 PMID: 28393238

Mogami (2018) Collagen Type 1 accelerates healing of ruptured fetal membranes. Sci Rep 8 696 PMID: 29330408


Do you know of a great paper that uses Obtustatin from Tocris? Please let us know.

Reviews for Obtustatin

Average Rating: 5 (Based on 1 Review.)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%

Have you used Obtustatin?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Filter by:


Collagen type 1 activated collagen receptor discoidin domain receptor.
By Anonymous on 02/21/2020
Assay Type: In Vitro
Species: Mouse
Cell Line/Tissue: 3D Culture Matrix

10 μg/ml treat 24h and 48h

PMID: 29330408
review image

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Angiogenesis in Cancer Poster

Angiogenesis in Cancer Poster

This poster summarizes the pathogenesis of angiogenesis in cancer, as well as some of the main angiogenesis therapeutic targets.

Enabling Research By Provision of Chemical Tools Poster

Enabling Research By Provision of Chemical Tools Poster

The Tocris chemistry team has considerable chemistry knowledge and skill which it has recently been applying to the generation of new chemical probes from known tools and compounds to help answer biological questions. This poster presents some of the work carried out by Tocris scientists and focuses on two areas: the generation of libraries of chemical building blocks to support Degrader (PROTAC) research and the development of a fluorescent probe to study integrin biology. Presented at Chemical Tools for Complex Biological Systems II, 2019, Janelia Research Campus, USA.