Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewELARR>GG
Discontinued Product
ELARR>GG (Cat. No. 6292) has been withdrawn from sale for commercial reasons.
Description: Negative control for ELA-32 (Cat.No.6291)
Alternative Names: ELA-32 negative control
Biological Activity for ELARR>GG
ELARR>GG is an ELABELA mutant peptide. Negative control for ELA-32 (Cat.No.6291).
Technical Data for ELARR>GG
| M. Wt | 3769.55 |
| Formula | C162H271N57O39S4 |
| Sequence |
QRPVNLTMGGKLRKHNCLQRRCMPLHSRVPFP (Modifications: Disulfide bridge: 17-22) |
| Storage | Store at -20°C |
| PubChem ID | 134812835 |
| InChI Key | PFBRCXLUNUYGJU-JZFBDHSDSA-N |
| Smiles | [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCSC)C(=O)NCC(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC1=O)C(=O)N[C@@H](CCSC)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N1CCC[C@H]1C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Product Datasheets for ELARR>GG
References for ELARR>GG
References are publications that support the biological activity of the product.
Ho et al (2015) ELABELA is an endogenous growth factor that sustains hESC self-renewal via the PI3K/AKT pathway. Cell Stem Cell 17 435 PMID: 26387754
View Related Products by Target
View Related Products by Product Action
Keywords: ELA RR-GG, ELA RR-GG supplier, ELA-32, negative, control, mutant, peptide, ELABELA, Apelin, Receptors, Stem, Cell, Proliferation, ESCs, and, iPSC, 6292, Tocris Bioscience
Citations for ELARR>GG
Citations are publications that use Tocris products.
Currently there are no citations for ELARR>GG.
Reviews for ELARR>GG
There are currently no reviews for this product. Be the first to review ELARR>GG and earn rewards!
Have you used ELARR>GG?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image