ELARR>GG

Pricing Availability Delivery Time Qty
Cat.No. 6292 - ELA RR-GG | Gln-Arg-Pro-Val-Asn-Leu-Thr-Met-Gly-Gly-Lys-Leu-Arg-Lys-His-Asn-Cys-Leu-Gln-Arg-Arg-Cys-Met-Pro-Leu-His-Ser-Arg-Val-Pro-Phe-Pro
Description: Negative control for ELA-32 (Cat.No.6291).
Alternative Names: ELA-32 negative control
Datasheet
Citations
Literature

Biological Activity

ELABELA mutant peptide. Negative control for ELA-32 (Cat.No.6291).

Technical Data

M. Wt 3769.55
Formula C162H271N57O39S4
Sequence QRPVNLTMGGKLRKHNCLQRRCMPLHSRVPFP

(Modifications: Disulfide bridge: 17-22)

Storage Store at -20°C
Smiles [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCSC)C(=O)NCC(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC1=O)C(=O)N[C@@H](CCSC)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N1CCC[C@H]1C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

All Tocris products are intended for laboratory research use only.

Solubility Data

SolubilitySoluble to 1 mg/ml in water

Preparing Stock Solutions

The following data is based on the product molecular weight 3769.55. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.

Concentration / Solvent Volume / Mass 1 mg 5 mg 10 mg
1 mM 0.27 mL 1.33 mL 2.65 mL
5 mM 0.05 mL 0.27 mL 0.53 mL
10 mM 0.03 mL 0.13 mL 0.27 mL
50 mM 0.01 mL 0.03 mL 0.05 mL

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Dilution Calculator

Calculate the dilution required to prepare a stock solution.
x
=
x

Product Datasheets

Safety Datasheet

References

References are publications that support the products' biological activity.

Ho et al (2015) ELABELA is an endogenous growth factor that sustains hESC self-renewal via the PI3K/AKT pathway. Cell Stem Cell 17 435 PMID: 26387754


If you know of a relevant reference for ELARR>GG, please let us know.

Keywords: ELA RR-GG, supplier, ELA-32, negative, control, mutant, peptide, ELABELA, ELA-32, negative, control, Apelin, Receptors, Stem, Cell, Proliferation, ESCs, and, iPSC, Apelin, Receptors, Tocris Bioscience

Citations for ELARR>GG

Citations are publications that use Tocris products.

Currently there are no citations for ELARR>GG. Do you know of a great paper that uses ELARR>GG from Tocris? If so please let us know.

ELA RR-GG Reviews

Average Rating:

(Based on 0 Reviews)


1 Star
0%
2 Star
0%
3 Star
0%
4 Star
0%
5 Star
0%

Have you used ELA RR-GG?

Submit a review and receive a $25US/€18/£15/$25CAN Amazon gift card if you include an image -$10US/€7/£6/$10CAN Amazon gift card for reviews without an image. Limited to verified customers in USA, Canada and Europe.


Literature in this Area

Cardiovascular

Cardiovascular Research Product Guide

A collection of over 250 products for cardiovascular research, the guide includes research tools for the study of:

  • Hypertension
  • Thrombosis and Hemostasis
  • Atherosclerosis
  • Myocardial Infarction
  • Ischemia/Reperfusion Injury
  • Arrhythmias
  • Heart Failure
GPCR

GPCR Product Listing

A collection of over 450 products for G protein-coupled receptors, the listing includes research tools for the study of:

  • Rhodopsin-like Receptors
  • Secretin-like Receptors
  • Glutamate Receptors
  • Frizzled Receptors
  • GPCR Signaling
Peptide Hormone Receptors

Peptide Hormone Receptors Product Listing

A collection of over 200 products for peptide hormone receptors, the listing includes research tools for the study of:

  • Anterior Pituitary Regulation
  • Blood Pressure Regulation
  • Feeding and Appetite Regulation
  • Glucose Regulation
  • Peptide Hormone Processing
Cardiovascular

Cardiovascular Poster

Cardiovascular disease remains one of the major causes of morbidity and mortality in the Western world and therefore this therapeutic area continues to be of great interest to researchers. This poster highlights the key GPCRs regulating vascular reactivity.