ELA-32 (human)

Pricing Availability Delivery Time Qty
Cat.No. 6291 - ELA-32 (human) | Gln-Arg-Pro-Val-Asn-Leu-Thr-Met-Arg-Arg-Lys-Leu-Arg-Lys-His-Asn-Cys-Leu-Gln-Arg-Arg-Cys-Met-Pro-Leu-His-Ser-Arg-Val-Pro-Phe-Pro | CAS No. 1680205-79-1
Description: Potent, high affinity apelin receptor agonist; stimulates angiogenesis
Alternative Names: APJ early endogenous ligand, Apela, Elabela, Toddler
Datasheet
Citations
Literature

Biological Activity

Potent, high affinity apelin receptor agonist (IC50 = 0.27 nM; Kd = 0.51 nM). Exhibits no binding GPR15 and GPR25. Activates the PI3K/AKT pathway and promotes self-renewal of hESCs via cell-cycle progression and protein translation. Also potentiates the TGFβ pathway, priming hESCs toward the endoderm lineage. Stimulates angiogenesis in HUVEC cells. Relaxes mouse aortic vessels. Functions as an anorexigenic hormone through activation of the AVP and CRH neurons in the PVN. Negative control (Cat.No. 6292) available.

Licensing Information

Sold under agreement from the Agency for Science, Technology and Research (A*STAR), ETPL, and affiliates including the Institute of Medical Biology.

Technical Data

M. Wt 3967.8
Formula C170H289N63O39S4
Sequence QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP

(Modifications: Disulfide bridge: 17-22)

Storage Store at -20°C
CAS Number 1680205-79-1
InChI Key QSDOQAYDPQAWEK-HLMHHTBMNA-N
Smiles [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC1=O)C(=O)N[C@@H](CCSC)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N1CCC[C@H]1C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

All Tocris products are intended for laboratory research use only.

Solubility Data

SolubilitySoluble to 1 mg/ml in water

Preparing Stock Solutions

The following data is based on the product molecular weight 3967.8. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.

Concentration / Solvent Volume / Mass 1 mg 5 mg 10 mg
1 mM 0.25 mL 1.26 mL 2.52 mL
5 mM 0.05 mL 0.25 mL 0.5 mL
10 mM 0.03 mL 0.13 mL 0.25 mL
50 mM 0.01 mL 0.03 mL 0.05 mL

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Dilution Calculator

Calculate the dilution required to prepare a stock solution.
x
=
x

Product Datasheets

Safety Datasheet

References

References are publications that support the products' biological activity.

Deng et al (2015) Apela Regulates Fluid Homeostasis by Binding to the APJ Receptor to Activate Gi Signaling. J.Biol.Chem 290 18261 PMID: 25995451

Wang et al (2015) Elabela-apelin receptor signaling pathway is functional in mammalian systems. Sci.Rep. 5 8170 PMID: 25639753

Chaves-Almagro et al (2015) Apelin receptors: From signaling to antidiabetic strategy. Eur.J.Pharmacol. 763 149 PMID: 26007641

Chng et al (2013) ELABELA: a hormone essential for heart development signals via the apelin receptor. Dev.Cell 27 672 PMID: 24316148

Ho et al (2015) ELABELA Is an Endogenous Growth Factor that Sustains hESC Self-Renewal via the PI3K/AKT Pathway. Cell Stem Cell 17 435 PMID: 26387754

Santoso et al (2015) Central action of ELABELA reduces food intake and activates arginine vasopressin and corticotropin-releasing hormone neurons in the hypothalamic paraventricular nucleus. Neuroreport 26 820 PMID: 26237243


If you know of a relevant reference for ELA-32 (human), please let us know.

View Related Products by Product Action

View all Apelin Receptor Agonists

Keywords: ELA-32 (human), supplier, APJ, early, endogenous, ligand, Apela, Elabela, Toddler, potent, high, affinity, apelin, receptors, agonists, agonism, self, renewal, hESCs, human, embryonic, cells, APJ, early, endogenous, ligand, Apela, Elabela, Toddler, Apelin, Receptors, Stem, Cell, Proliferation, ESCs, and, iPSC, Apelin, Receptors, Tocris Bioscience

Citations for ELA-32 (human)

Citations are publications that use Tocris products.

Currently there are no citations for ELA-32 (human). Do you know of a great paper that uses ELA-32 (human) from Tocris? If so please let us know.

ELA-32 (human) Reviews

Average Rating:

(Based on 0 Reviews)


1 Star
0%
2 Star
0%
3 Star
0%
4 Star
0%
5 Star
0%

Have you used ELA-32 (human)?

Submit a review and receive a $25US/€18/£15/$25CAN Amazon gift card if you include an image -$10US/€7/£6/$10CAN Amazon gift card for reviews without an image. Limited to verified customers in USA, Canada and Europe.


Literature in this Area

Cardiovascular

Cardiovascular Research Product Guide

A collection of over 250 products for cardiovascular research, the guide includes research tools for the study of:

  • Hypertension
  • Thrombosis and Hemostasis
  • Atherosclerosis
  • Myocardial Infarction
  • Ischemia/Reperfusion Injury
  • Arrhythmias
  • Heart Failure
GPCR

GPCR Product Listing

A collection of over 450 products for G protein-coupled receptors, the listing includes research tools for the study of:

  • Rhodopsin-like Receptors
  • Secretin-like Receptors
  • Glutamate Receptors
  • Frizzled Receptors
  • GPCR Signaling
Peptide Hormone Receptors

Peptide Hormone Receptors Product Listing

A collection of over 200 products for peptide hormone receptors, the listing includes research tools for the study of:

  • Anterior Pituitary Regulation
  • Blood Pressure Regulation
  • Feeding and Appetite Regulation
  • Glucose Regulation
  • Peptide Hormone Processing
Cardiovascular

Cardiovascular Poster

Cardiovascular disease remains one of the major causes of morbidity and mortality in the Western world and therefore this therapeutic area continues to be of great interest to researchers. This poster highlights the key GPCRs regulating vascular reactivity.