ELA-32 (human)

Discontinued Product

ELA-32 (human) (Cat. No. 6291) has been withdrawn from sale for commercial reasons.
Description: Potent and high affinity apelin agonist; stimulates angiogenesis
Alternative Names: APJ early endogenous ligand, Apela, Elabela, Toddler
Datasheet
Citations
Reviews

Biological Activity for ELA-32 (human)

ELA-32 (human) is a potent, high affinity apelin receptor agonist (IC50 = 0.27 nM; Kd = 0.51 nM). Exhibits no binding GPR15 and GPR25. Activates the PI3K/AKT pathway and promotes self-renewal of hESCs via cell-cycle progression and protein translation. Also potentiates the TGFβ pathway, priming hESCs toward the endoderm lineage. Stimulates angiogenesis in HUVEC cells. Relaxes mouse aortic vessels. Functions as an anorexigenic hormone through activation of the AVP and CRH neurons in the PVN.

Negative control (Cat.No. 6292) also available.

Licensing Information

Sold under agreement from the Agency for Science, Technology and Research (A*STAR), ETPL, and affiliates including the Institute of Medical Biology.

Technical Data for ELA-32 (human)

M. Wt 3967.8
Formula C170H289N63O39S4
Sequence QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP

(Modifications: Disulfide bridge: 17-22)

Storage Store at -20°C
CAS Number 1680205-79-1
PubChem ID 131648248
InChI Key QSDOQAYDPQAWEK-PXWSXZDTSA-N
Smiles [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC1=O)C(=O)N[C@@H](CCSC)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N1CCC[C@H]1C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets for ELA-32 (human)

Certificate of Analysis / Product Datasheet
Select another batch:

View Related Products by Product Action

View all Apelin Receptor Agonists

Keywords: ELA-32 (human), ELA-32 (human) supplier, APJ, early, endogenous, ligand, Apela, Elabela, Toddler, potent, high, affinity, apelin, receptors, agonists, agonism, self, renewal, hESCs, human, embryonic, cells, Apelin, Receptors, Stem, Cell, Proliferation, ESCs, and, iPSC, 6291, Tocris Bioscience

Citations for ELA-32 (human)

Citations are publications that use Tocris products.

Currently there are no citations for ELA-32 (human).

Reviews for ELA-32 (human)

There are currently no reviews for this product. Be the first to review ELA-32 (human) and earn rewards!

Have you used ELA-32 (human)?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review