Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit Review5184 has been discontinued.
View all Voltage-gated Potassium (K<sub>V</sub>) Channels products.BDS I is a potent and reversible Kv3.4 potassium channel blocker (IC50 = 47 nM); also attenuates inactivation of sodium currents by acting on Nav1.7 and Nav1.3 channels. Enhances TTX-sensitive sodium currents in rat small dorsal root ganglion neurons. Neuroprotective.
| M. Wt | 4708.37 |
| Formula | C210H297N57O56S6 |
| Sequence |
AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH (Modifications: Disulfide bridge: 4-39,6-32,22-40) |
| Storage | Store at -20°C |
| PubChem ID | 90489021 |
| InChI Key | NHDQBZJQNKDJOQ-UHFFFAOYSA-N |
| Smiles | [H]N[C@@H](C)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H]3CCCN3C(=O)[C@H](CC3=CNC4=C3C=CC=C4)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC3=CC=C(O)C=C3)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CC=CC=C4)NC1=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC4=C1C=CC=C4)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CSSC[C@H](NC2=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CNC=N1)C(O)=O)C(=O)N1CCC[C@H]1C(=O)NCC(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N3)[C@@H](C)CC |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
References are publications that support the biological activity of the product.
Diochot et al (1998) Sea anemone peptides with a specific blocking activity against the fast inactivating potassium channel Kv3.4. J.Biol.Chem. 273 6744 PMID: 9506974
Liu et al (2012) Modulation of neuronal sodium channels by the sea anemone peptide BDS-I. J.Neurophysiol. 107 3155 PMID: 22442564
Pannaccione et al (2007) Up-regulation and increased activity of KV3.4 channels and their accessory subunit MinK-related peptide 2 induced by amyloid peptide are involved in apoptotic neuronal death. Mol.Pharmacol. 72 665 PMID: 17495071
Keywords: BDS I, BDS I supplier, BDSI, blood, depressing, substance, 1, potent, reversible, Kv3.4, potassium, channels, blockers, attenuated, inactivation, sodium, currents, Nav1.7, and, Nav1.3, neuroprotective, venoms, BDS1, BDS, BDS-1, Blood, Voltage-Gated, Potassium, Channels, Voltage-gated, Sodium, 5184, Tocris Bioscience
Citations are publications that use Tocris products.
Currently there are no citations for BDS I.
Average Rating: 5 (Based on 1 Review.)
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Filter by: