RVG29-Cys

Pricing Availability   Qty
Description: Nicotinic acetylcholine receptor targeting peptide for neuronal delivery
Purity: ≥95% (HPLC)
Datasheet
Citations
Reviews

Biological Activity for RVG29-Cys

RVG29-Cys is a peptide derived from rabies virus glycoprotein (RVG) able to specifically bind on the nicotinic acetylcholine receptors (nAchR) present on neuronal cells. RVG29-Cys can be used to functionalize LNPs via thiol-maleimide click chemistry for targeting nAchR present on blood-brain barrier (BBB). mRNA LNPs functionalized with RVG29-Cys shows improved transfection efficiency in cultured brain endothelial and neuronal cells, and in vivo, after systemic administration in mice.

Technical Data for RVG29-Cys

M. Wt 3369.79
Formula C144H222N44O44S3
Sequence YTIWMPENPRPGTPCDIFTNSRGKRASNGC
Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 1404289-25-3
PubChem ID 172898615
InChI Key SQWGWNJDPJYWQQ-FMHCIDBQSA-N
Smiles O=C(N[C@@H]([C@H](O)C)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC1=CNC2=CC=CC=C12)C(N[C@@H](CCSC)C(N3[C@@H](CCC3)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC(N)=O)C(N4[C@@H](CCC4)C(N[C@@H](CCCNC(N)=N)C(N5[C@@H](CCC5)C(NCC(N[C@@H]([C@H](O)C)C(N6[C@@H](CCC6)C(N[C@@H](CS)C(N[C@@H](CC(O)=O)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC7=CC=CC=C7)C(N[C@@H]([C@H](O)C)C(N[C@@H](CC(N)=O)C(N[C@@H](CO)C(N[C@@H](CCCNC(N)=N)C(NCC(N[C@@H](CCCCN)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](C)C(N[C@@H](CO)C(N[C@@H](CC(N)=O)C(NCC(N[C@@H](CS)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC8=CC=C(C=C8)O)N

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for RVG29-Cys

Solubility Soluble to 1 mg/ml in water

References for RVG29-Cys

References are publications that support the biological activity of the product.

Han et al (2025) Peptide-functionalized lipid nanoparticles for targeted systemic mRNA delivery to the brain. Nano Lett. 25 800 PMID: 39688915

Liu et al (2009) Brain-targeting gene delivery and cellular internalization mechanisms for modified rabies virus glycoprotein RVG29 nanoparticles. Biomaterials 30 4195 PMID: 19467700


If you know of a relevant reference for RVG29-Cys, please let us know.

Keywords: RVG29-Cys, RVG29-Cys supplier, RVG29, RVG29Cys, RVG, Lipid, nanoparticles, LNP, mRNA, peptides, brain, tissue, delivery, blood-brain, barrier, BBB, neurons, endocytosis, transcytosis, in, vivo, Nanoparticles, Endocytosis, 8903, Tocris Bioscience

Citations for RVG29-Cys

Citations are publications that use Tocris products.

Currently there are no citations for RVG29-Cys. Do you know of a great paper that uses RVG29-Cys from Tocris? Please let us know.

Reviews for RVG29-Cys

There are currently no reviews for this product. Be the first to review RVG29-Cys and earn rewards!

Have you used RVG29-Cys?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review