ProTx II

Pricing Availability   Qty

Save 15% on Select RUO Reagents. See Details. 

Description: Selective NaV1.7 channel blocker
Purity: ≥95% (HPLC)
Datasheet
Citations (2)
Reviews

Biological Activity for ProTx II

ProTx II is a selective NaV1.7 channel blocker. Shifts activation gating positively and decreases current magnitude. Displays 100-fold selectivity over other sodium channel subtypes.

Technical Data for ProTx II

M. Wt 3826.59
Formula C168H250N46O41S8
Sequence YCQKWMWTCDSERKCCEGMVCRLWCKKKLW

(Modifications: Disulfide bridges: 2-16, 9-21, 15-25)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 484598-36-9
PubChem ID 118708662
InChI Key XOAUGYVLRSCGBG-ZJDFQAAZSA-N
Smiles [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC1=O)[C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N3)NC(=O)[C@@H](NC(=O)[C@H](CCSC)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC2=O)C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for ProTx II

Solubility Soluble to 1 mg/ml in water

Product Datasheets for ProTx II

Certificate of Analysis / Product Datasheet
Select another batch:

References for ProTx II

References are publications that support the biological activity of the product.

Smith et al (2007) Molecular interactions of the gating modifier toxin ProTx-II with NaV 1.5: implied existence of a novel toxin binding site coupled to activation. J.Biol.Chem. 282 12687 PMID: 17339321

Edgerton et al (2008) Evidence for multiple effects of ProTxII on activation gating in NaV 1.5. Toxicon. 52 489 PMID: 18657562

Schmalhofer et al (2008) ProTx-II, a selective inhibitor of NaV 1.7 sodium channels, blocks action potential propagation in nociceptors. Mol.Pharmacol. 74 1476 PMID: 18728100

Xu et al (2019) Structural basis of Nav1.7 inhibition by a gating-modifier spider toxin. Cell. 176 702 PMID: 30661758


If you know of a relevant reference for ProTx II, please let us know.

View Related Products by Product Action

View all Voltage-gated Sodium (NaV) Channel Blockers

Keywords: ProTx II, ProTx II supplier, toxins, voltage, gated, sodium, Na+, channels, NaV1.7, potent, selective, blockers, venoms, Voltage-gated, Sodium, Channels, 4023, Tocris Bioscience

2 Citations for ProTx II

Citations are publications that use Tocris products. Selected citations for ProTx II include:

Shen et al (2019) Structures of human Nav1.7 channel in complex with auxiliary subunits and animal toxins. Science 363 1303 PMID: 30765606

Li et al (2017) Membrane protein Nav1.7 contributes to the persistent post-surgical pain regulated by p-p65 in dorsal root ganglion (DRG) of SMIR rats model. BMC Anesthesiol 17 150 PMID: 29115943


Do you know of a great paper that uses ProTx II from Tocris? Please let us know.

Reviews for ProTx II

There are currently no reviews for this product. Be the first to review ProTx II and earn rewards!

Have you used ProTx II?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review