Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewLiraglutide is a highly potent, long-acting GLP-1 receptor agonist (EC50 = 61 pM). Acylated derivative of GLP-1 (7-37) (Cat. No. 5374). Inhibits food and water intake, causing lasting and reversible weight loss in normal and obese rats. In an animal model of Alzheimer's disease, Liraglutide decreases levels of Aβ and soluble amyloid, and reduces neuroinflammation.
M. Wt | 3751.24 |
Formula | C172H265N43O51 |
Sequence |
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG (Modifications: Lys-20 = Lys-(γ-Glu-palmitoyl)) |
Storage | Store at -20°C |
Purity | ≥95% (HPLC) |
CAS Number | 204656-20-2 |
PubChem ID | 16134956 |
InChI Key | YSDQQAXHVYUZIW-QCIJIYAXSA-N |
Smiles | CCCCCCCCCCCCCCCC(=O)N[C@@H](CCC(=O)NCCCC[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC2=CNC3=CC=CC=C32)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(=O)N)NC(=O)CNC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC4=CC=C(C=C4)O)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC5=CC=CC=C5)NC(=O)[C@H]([C@@H](C)O)NC(=O)CNC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](CC6=CN=CN6)N)C(=O)O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility | Soluble to 1 mg/ml in 0.01M PBS (pH 7.4) |
References are publications that support the biological activity of the product.
Knudsen et al (2000) Potent derivatives of glucagon-like peptide-1 with pharmacokinetic properties suitable for once daily administration. J.Med.Chem. 43 1664 PMID: 10794683
Larsen et al (2001) Systemic administration of the long-acting GLP-1 derivative NN2211 induces lasting and reversible weight loss in both normal and obese rats. Diabetes 50 2530 PMID: 11679431
Paladugu et al (2021) Liraglutide has anti-inflammatory and anti-amyloid properties in streptozotocin-induced and 5xFAD mouse models of Alzheimer's disease. Int.J.Mol.Sci. 22 860 PMID: 33467075
McClean et al (2011) The diabetes drug liraglutide prevents degenerative processes in a mouse model of Alzheimer's disease. J.Neurosci. 31 6587 PMID: 21525299
If you know of a relevant reference for Liraglutide, please let us know.
Keywords: Liraglutide, Liraglutide supplier, Liraglutide, NN2211, potent, GLP-1, receptor, agonists, agonism, analogue, analog, anti-obesity, anorectic, anti-amyloid, Ab, Abeta, Aβ, Glucagon-Like, Peptide, 1, Receptors, Amyloid, Beta, Peptides, 6517, Tocris Bioscience
Citations are publications that use Tocris products.
Currently there are no citations for Liraglutide. Do you know of a great paper that uses Liraglutide from Tocris? Please let us know.
There are currently no reviews for this product. Be the first to review Liraglutide and earn rewards!
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.