Liraglutide

Pricing Availability   Qty

Save 26% on Select RUO Reagents. See Details

Description: Highly potent, long-acting GLP-1 receptor agonist
Alternative Names: NN2211
Purity: ≥95% (HPLC)
Datasheet
Citations (2)
Reviews
Literature (1)

Biological Activity for Liraglutide

Liraglutide is a highly potent, long-acting GLP-1 receptor agonist (EC50 = 61 pM). Acylated derivative of GLP-1 (7-37) (Cat. No. 5374). Inhibits food and water intake, causing lasting and reversible weight loss in normal and obese rats. In an animal model of Alzheimer's disease, Liraglutide decreases levels of Aβ and soluble amyloid, and reduces neuroinflammation.

Technical Data for Liraglutide

M. Wt 3751.24
Formula C172H265N43O51
Sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG

(Modifications: Lys-20 = Lys-(γ-Glu-palmitoyl))

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 204656-20-2
PubChem ID 16134956
InChI Key YSDQQAXHVYUZIW-QCIJIYAXSA-N
Smiles CCCCCCCCCCCCCCCC(=O)N[C@@H](CCC(=O)NCCCC[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC2=CNC3=CC=CC=C32)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(=O)N)NC(=O)CNC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC4=CC=C(C=C4)O)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC5=CC=CC=C5)NC(=O)[C@H]([C@@H](C)O)NC(=O)CNC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](CC6=CN=CN6)N)C(=O)O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for Liraglutide

Solubility Soluble to 1 mg/ml in 0.01M PBS (pH 7.4)

Product Datasheets for Liraglutide

Certificate of Analysis / Product Datasheet
Select another batch:

References for Liraglutide

References are publications that support the biological activity of the product.

Knudsen et al (2000) Potent derivatives of glucagon-like peptide-1 with pharmacokinetic properties suitable for once daily administration. J.Med.Chem. 43 1664 PMID: 10794683

Larsen et al (2001) Systemic administration of the long-acting GLP-1 derivative NN2211 induces lasting and reversible weight loss in both normal and obese rats. Diabetes 50 2530 PMID: 11679431

Paladugu et al (2021) Liraglutide has anti-inflammatory and anti-amyloid properties in streptozotocin-induced and 5xFAD mouse models of Alzheimer's disease. Int.J.Mol.Sci. 22 860 PMID: 33467075

McClean et al (2011) The diabetes drug liraglutide prevents degenerative processes in a mouse model of Alzheimer's disease. J.Neurosci. 31 6587 PMID: 21525299


If you know of a relevant reference for Liraglutide, please let us know.

View Related Products by Product Action

View all Glucagon-Like Peptide 1 Receptor Agonists

Keywords: Liraglutide, Liraglutide supplier, Liraglutide, NN2211, potent, GLP-1, receptor, agonists, agonism, analogue, analog, anti-obesity, anorectic, anti-amyloid, Ab, Abeta, Aβ, Glucagon-Like, Peptide, 1, Receptors, Amyloid, Beta, Peptides, 6517, Tocris Bioscience

2 Citations for Liraglutide

Citations are publications that use Tocris products. Selected citations for Liraglutide include:

Steven W et al (2022) Liraglutide Counteracts Endoplasmic Reticulum Stress in Palmitate-Treated Hypothalamic Neurons without Restoring Mitochondrial Homeostasis. Int J Mol Sci 24 PMID: 36614074

David et al (2023) Osmoadaptive GLP-1R signalling in hypothalamic neurones inhibits antidiuretic hormone synthesis and release. Mol Metab 70 101692 PMID: 36773648


Do you know of a great paper that uses Liraglutide from Tocris? Please let us know.

Reviews for Liraglutide

There are currently no reviews for this product. Be the first to review Liraglutide and earn rewards!

Have you used Liraglutide?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Peptides Involved in Appetite Modulation Scientific Review

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.