Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewJingzhaotoxin III is a selective blocker of NaV1.5 channels (IC50 = 348 nM); displays no effect on other isoforms, including NaV1.2, NaV1.4, NaV1.6 and NaV1.7. Thought to inhibit sodium channel activation by binding to the NaV1.5 S3-S4 linker of domain II. Selectively inhibits the activation of cardiac sodium channels, but has no effect on sodium channels in dorsal root ganglion neurons.
M. Wt | 3919.5 |
Formula | C174H241N47O46S6 |
Sequence |
DGECGGFWWKCGRGKPPCCKGYACSKTWGWCAVEAP (Modifications: Disulfide bridges: 4-19, 11-24, 18-31) |
Storage | Store at -20°C |
Purity | ≥95% (HPLC) |
CAS Number | 925463-91-8 |
PubChem ID | 90488988 |
InChI Key | OKELXNUZHJLTAQ-UHFFFAOYSA-N |
Smiles | [H]N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)CNC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CC4=CC=CC=C4)NC(=O)CNC(=O)CNC1=O)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N3)NC(=O)[C@H](C)NC(=O)[C@H](CC1=CC=C(O)C=C1)NC(=O)CNC(=O)[C@H](CCCCN)NC2=O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility | Soluble to 1 mg/ml in water |
References are publications that support the biological activity of the product.
Xiao et al (2004) Jingzhaotoxin-III, a novel spider toxin inhibiting activation of sodium channel in rat cardiac myocytes. J.Biol.Chem. 279 26220 PMID: 15084603
Rong et al (2011) Molecular basis of the tarantula toxin jingzhaotoxin-III (β-TRTX-Cj1α) interacting with voltage sensors in sodium channel subtype Nav1.5. FASEB J. 25 3177 PMID: 21665957
If you know of a relevant reference for Jingzhaotoxin III, please let us know.
Keywords: Jingzhaotoxin III, Jingzhaotoxin III supplier, cardiotoxins, NaV1.5, selective, ion, channels, sodium, blockers, blocks, inhibitors, inhibits, venoms, Voltage-gated, Sodium, Channels, 4913, Tocris Bioscience
Citations are publications that use Tocris products.
Currently there are no citations for Jingzhaotoxin III. Do you know of a great paper that uses Jingzhaotoxin III from Tocris? Please let us know.
There are currently no reviews for this product. Be the first to review Jingzhaotoxin III and earn rewards!
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image