Jingzhaotoxin III

Pricing Availability   Qty
Description: Selective NaV1.5 channel blocker
Purity: ≥95% (HPLC)
Datasheet
Citations
Reviews

Biological Activity for Jingzhaotoxin III

Jingzhaotoxin III is a selective blocker of NaV1.5 channels (IC50 = 348 nM); displays no effect on other isoforms, including NaV1.2, NaV1.4, NaV1.6 and NaV1.7. Thought to inhibit sodium channel activation by binding to the NaV1.5 S3-S4 linker of domain II. Selectively inhibits the activation of cardiac sodium channels, but has no effect on sodium channels in dorsal root ganglion neurons.

Technical Data for Jingzhaotoxin III

M. Wt 3919.5
Formula C174H241N47O46S6
Sequence DGECGGFWWKCGRGKPPCCKGYACSKTWGWCAVEAP

(Modifications: Disulfide bridges: 4-19, 11-24, 18-31)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 925463-91-8
PubChem ID 90488988
InChI Key OKELXNUZHJLTAQ-UHFFFAOYSA-N
Smiles [H]N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)CNC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CC4=CC=CC=C4)NC(=O)CNC(=O)CNC1=O)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N3)NC(=O)[C@H](C)NC(=O)[C@H](CC1=CC=C(O)C=C1)NC(=O)CNC(=O)[C@H](CCCCN)NC2=O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for Jingzhaotoxin III

Solubility Soluble to 1 mg/ml in water

Product Datasheets for Jingzhaotoxin III

Certificate of Analysis / Product Datasheet
Select another batch:

References for Jingzhaotoxin III

References are publications that support the biological activity of the product.

Xiao et al (2004) Jingzhaotoxin-III, a novel spider toxin inhibiting activation of sodium channel in rat cardiac myocytes. J.Biol.Chem. 279 26220 PMID: 15084603

Rong et al (2011) Molecular basis of the tarantula toxin jingzhaotoxin-III (β-TRTX-Cj1α) interacting with voltage sensors in sodium channel subtype Nav1.5. FASEB J. 25 3177 PMID: 21665957


If you know of a relevant reference for Jingzhaotoxin III, please let us know.

View Related Products by Product Action

View all Voltage-gated Sodium (NaV) Channel Blockers

Keywords: Jingzhaotoxin III, Jingzhaotoxin III supplier, cardiotoxins, NaV1.5, selective, ion, channels, sodium, blockers, blocks, inhibitors, inhibits, venoms, Voltage-gated, Sodium, Channels, 4913, Tocris Bioscience

Citations for Jingzhaotoxin III

Citations are publications that use Tocris products.

Currently there are no citations for Jingzhaotoxin III. Do you know of a great paper that uses Jingzhaotoxin III from Tocris? Please let us know.

Reviews for Jingzhaotoxin III

There are currently no reviews for this product. Be the first to review Jingzhaotoxin III and earn rewards!

Have you used Jingzhaotoxin III?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review