Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewHuwentoxin IV
Discontinued Product
4718 has been discontinued.
View all Voltage-gated Sodium (Na<sub>V</sub>) Channels products.
Description: Selective NaV1.7 channel blocker
Biological Activity for Huwentoxin IV
Huwentoxin IV is a selective NaV1.7 channel blocker. Preferentially inhibits neuronal NaV1.7, 1.2 and 1.3 (IC50 values are 26, 150 and 338 nM respectively), compared to muscle subtypes NaV1.4 and 1.5 (IC50 = >10 μM). Inhibits the channel by binding at the neurotoxin receptor site 4 in the S3-S4 linker of domain II, trapping the voltage sensor in the inward, closed configuration.
Technical Data for Huwentoxin IV
| M. Wt | 4106.79 |
| Formula | C174H278N52O51S6 |
| Sequence |
ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI (Modifications: Disulfide bridge: 2-17,9-24,16-31) (Modifications: Ile-35 = C-terminal amide) |
| Storage | Store at -20°C |
| CAS Number | 526224-73-7 |
| PubChem ID | 90488968 |
| InChI Key | MJMLBAPXMAOKDU-UHFFFAOYSA-N |
| Smiles | [H]N[C@@H](CCC(O)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC4=CC=CC=C4)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC1=O)[C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N3)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC2=O)C(C)C)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(N)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Product Datasheets for Huwentoxin IV
References for Huwentoxin IV
References are publications that support the biological activity of the product.
Xiao et al (2008) Tarantula huwentoxin-IV inhibits neuronal sodium channels by binding to receptor site 4 and trapping the domain II voltage sensor in the closed configuration. J.Biol.Chem. 283 27300 PMID: 18628201
Xiao et al (2011) Common molecular determinants of tarantula huwentoxin-IV inhibition of Na+ channel voltage sensors in domains II and IV. J.Biol.Chem. 286 27301 PMID: 21659528
View Related Products by Target
View Related Products by Product Action
Keywords: Huwentoxin IV, Huwentoxin IV supplier, Huwentoxin, 4, sodium, channels, NaV1.7, blockers, antagonists, toxins, voltage, gated, Na+, selective, venoms, Voltage-gated, Sodium, Channels, 4718, Tocris Bioscience
1 Citation for Huwentoxin IV
Citations are publications that use Tocris products. Selected citations for Huwentoxin IV include:
Shen et al (2019) Structures of human Nav1.7 channel in complex with auxiliary subunits and animal toxins. Science 363 1303 PMID: 30765606
Reviews for Huwentoxin IV
There are currently no reviews for this product. Be the first to review Huwentoxin IV and earn rewards!
Have you used Huwentoxin IV?
Submit a review and receive an Amazon gift card.
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image