Home / Pharmacology / Ion Channels / Sodium Channels / Voltage-gated Sodium (NaV) Channels / Voltage-gated Sodium (NaV) Channel Blockers / Huwentoxin IV

Huwentoxin IV

Cat. No. 4718 Submit a Review Datasheet / COA / SDS
Pricing Availability Delivery Time Qty
Cat.No. 4718 - Huwentoxin IV | Glu-Cys-Leu-Glu-Ile-Phe-Lys-Ala-Cys-Asn-Pro-Ser-Asn-Asp-Gln-Cys-Cys-Lys-Ser-Ser-Lys-Leu-Val-Cys-Ser-Arg-Lys-Thr-Arg-Trp-Cys-Lys-Tyr-Gln-Ile-NH2 | CAS No. 526224-73-7
Description: Selective NaV1.7 channel blocker
Datasheet
Citations
Reviews
Literature
Biological Activity Technical Data Solubility Calculators Datasheets References

Biological Activity

Selective NaV1.7 channel blocker. Preferentially inhibits neuronal NaV1.7, 1.2 and 1.3 (IC50 values are 26, 150 and 338 nM respectively), compared to muscle subtypes NaV1.4 and 1.5 (IC50 = >10 μM). Inhibits the channel by binding at the neurotoxin receptor site 4 in the S3-S4 linker of domain II, trapping the voltage sensor in the inward, closed configuration.

Technical Data

M. Wt 4106.79
Formula C174H278N52O51S6
Sequence ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI

(Modifications: Disulfide bridge: 2-17,9-24,16-31)

(Modifications: Ile-35 = C-terminal amide)
Storage Store at -20°C
CAS Number 526224-73-7
PubChem ID 90488968
InChI Key MJMLBAPXMAOKDU-UHFFFAOYSA-N
Smiles [H]N[C@@H](CCC(O)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC4=CC=CC=C4)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC1=O)[C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N3)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC2=O)C(C)C)[C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

All Tocris products are intended for laboratory research use only.

Solubility Data

Solubility Soluble to 1 mg/ml in water

Preparing Stock Solutions

The following data is based on the product molecular weight 4106.79. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.

Concentration / Solvent Volume / Mass 1 mg 5 mg 10 mg
1 mM 0.24 mL 1.22 mL 2.43 mL
5 mM 0.05 mL 0.24 mL 0.49 mL
10 mM 0.02 mL 0.12 mL 0.24 mL
50 mM 0 mL 0.02 mL 0.05 mL

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Dilution Calculator

Calculate the dilution required to prepare a stock solution.
x
=
x

Product Datasheets

Certificate of Analysis / Product Datasheet
Safety Datasheet

References

References are publications that support the biological activity of the product.

Xiao et al (2008) Tarantula huwentoxin-IV inhibits neuronal sodium channels by binding to receptor site 4 and trapping the domain II voltage sensor in the closed configuration. J.Biol.Chem. 283 27300 PMID: 18628201

Xiao et al (2011) Common molecular determinants of tarantula huwentoxin-IV inhibition of Na+ channel voltage sensors in domains II and IV. J.Biol.Chem. 286 27301 PMID: 21659528

If you know of a relevant reference for Huwentoxin IV, please let us know.

View Related Products by Target

View Related Products by Product Action

View all Voltage-gated Sodium (NaV) Channel Blockers

Keywords: Huwentoxin IV, Huwentoxin IV supplier, Huwentoxin, 4, sodium, channels, NaV1.7, blockers, antagonists, toxins, voltage, gated, Na+, selective, venoms, Voltage-gated, Sodium, Channels, 4718, Tocris Bioscience

Citations for Huwentoxin IV

Citations are publications that use Tocris products.

Currently there are no citations for Huwentoxin IV. Do you know of a great paper that uses Huwentoxin IV from Tocris? Please let us know.

Reviews for Huwentoxin IV

There are currently no reviews for this product. Be the first to review Huwentoxin IV and earn rewards!

Have you used Huwentoxin IV?

Submit a review and receive an Amazon gift card.

$10US/$10CAN/€7/£6 gift card for a review without an image

$25US/$25CAN/€18/£15 gift card for a review with an image

*Offer only valid in the USA / Canada, UK and Europe

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* or download your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.

Cancer

Cancer Research Product Guide

A collection of over 750 products for cancer research, the guide includes research tools for the study of:

  • Cancer Metabolism
  • Epigenetics in Cancer
  • Receptor Signaling
  • Cell Cycle and DNA Damage Repair
  • Angiogenesis
  • Invasion and Metastasis
Cardiovascular

Cardiovascular Research Product Guide

A collection of over 250 products for cardiovascular research, the guide includes research tools for the study of:

  • Hypertension
  • Thrombosis and Hemostasis
  • Atherosclerosis
  • Myocardial Infarction
  • Ischemia/Reperfusion Injury
  • Arrhythmias
  • Heart Failure
Pain

Pain Research Product Guide

A collection of over 250 products for pain research, the guide includes research tools for the study of:

  • Nociception
  • Ion Channels
  • G-Protein-Coupled Receptors
  • Intracellular Signaling