Echistatin, α1 isoform

Pricing Availability   Qty
Description: αVβ3 and glycoprotein IIb/IIIa (integrin αIIbβ3) inhibitor
Purity: ≥95% (HPLC)
Datasheet
Citations (2)
Reviews
Literature (3)

Biological Activity for Echistatin, α1 isoform

Echistatin, α1 isoform is a potent irreversible αVβ3 integrin antagonist (Ki = 0.27 nM). Disrupts attachment of osteoclasts to bone and inhibits bone reabsorption (IC50 = 0.1 nM). Prevents ADP-induced platelet aggregation via inhibition of glycoprotein IIb/IIIa (GpIIb/IIIa, αIIbβ3) receptors (IC50 = 30 nM) in vitro.

Technical Data for Echistatin, α1 isoform

M. Wt 5417.1
Formula C217H341N71O74S9
Sequence ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

(Modifications: Disulfide bridges: 2-11, 7-32, 8-37, 20-39)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 154303-05-6
PubChem ID 90488810
InChI Key KZMZKUVIDVBQGX-UHFFFAOYSA-N
Smiles [H]N[C@@H](CCC(O)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]3CSSC[C@@H]4NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@@H]5CCCN5C(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC1=O)C(=O)N3)NC(=O)[C@H](CC1=CC=C(O)C=C1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CC(O)=O)NC4=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)[C@H](CCCCN)NC2=O)[C@@H](C)O)[C@@H](C)CC)[C@@H](C)O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for Echistatin, α1 isoform

Solubility Soluble to 1 mg/ml in water

Product Datasheets for Echistatin, α1 isoform

Certificate of Analysis / Product Datasheet
Select another batch:

References for Echistatin, α1 isoform

References are publications that support the biological activity of the product.

Musial et al (1990) Inhibition of platelet adhesion to surfaces of extracorporeal circuits by disintegrins RGD-containing peptides from viper venoms. Circulation 82 261 PMID: 2364514

Sato et al (1990) Echistatin is a potent inhibitor of bone resorption in culture. J.Cell.Biol. 111 1713 PMID: 2211834

Kumar et al (1997) Biochemical characteriation of the binding of echistatin to integrin αVβ3 receptor. J.Pharmacol.Exp.Ther. 283 843 PMID: 9353406


If you know of a relevant reference for Echistatin, α1 isoform, please let us know.

View Related Products by Product Action

View all Integrin Inhibitors

Keywords: Echistatin, alpha1 isoform, Echistatin, alpha1 isoform supplier, αVβ3, alphaVβ3, beta3, glycoprotein, IIb/IIIa, αIIbβ3, alphaIIbβ3, inhibitors, inhibits, Integrin, Receptors, Adhesion, Molecules, Echistatin, alpha1, isoform, Echistatina1, alphavbeta3, Cell, Integrins, 3202, Tocris Bioscience

2 Citations for Echistatin, α1 isoform

Citations are publications that use Tocris products. Selected citations for Echistatin, α1 isoform include:

Lin et al (2013) Angiopoietin-like 3 induces podocyte F-actin rearrangement through integrin α(V)β3/FAK/PI3K pathway-mediated Rac1 activation. PLoS One 2013 135608 PMID: 24294595

Schrader et al (2011) Matrix stiffness modulates proliferation, chemotherapeutic response, and dormancy in hepatocellular carcinoma cells. Biomed Res Int 53 1192 PMID: 21442631


Do you know of a great paper that uses Echistatin, α1 isoform from Tocris? Please let us know.

Reviews for Echistatin, α1 isoform

There are currently no reviews for this product. Be the first to review Echistatin, α1 isoform and earn rewards!

Have you used Echistatin, α1 isoform?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Immunology Product Listing

Immunology Product Listing

A collection of over 190 products for immunology research, the guide includes research tools for the study of:

  • Chemokine and Cytokine Signaling
  • Chemotaxis
  • Complement System
  • Immune Cell Signaling
  • Inflammation
Angiogenesis in Cancer Poster

Angiogenesis in Cancer Poster

Adapted from the 2015 Cancer Product Guide, Edition 3, this poster summarizes the pathogenesis of angiogenesis in cancer, as well as some of the main angiogenesis therapeutic targets.

Enabling Research By Provision of Chemical Tools Poster

Enabling Research By Provision of Chemical Tools Poster

The Tocris chemistry team has considerable chemistry knowledge and skill which it has recently been applying to the generation of new chemical probes from known tools and compounds to help answer biological questions. This poster presents some of the work carried out by Tocris scientists and focuses on two areas: the generation of libraries of chemical building blocks to support Degrader (PROTAC) research and the development of a fluorescent probe to study integrin biology. Presented at Chemical Tools for Complex Biological Systems II, 2019, Janelia Research Campus, USA.