ω-Agatoxin TK

Discontinued Product

2802 has been discontinued.

View all Ca<sub>V</sub>2.x Channels products.
Description: CaV2.1 blocker
Alternative Names: Agatoxin IVB
Purity: ≥95% (HPLC)
Datasheet
Citations (5)
Reviews (1)

Biological Activity for ω-Agatoxin TK

ω-Agatoxin TK is a selective blocker of CaV2.1 P/Q-type calcium channels.

Technical Data for ω-Agatoxin TK

M. Wt 5273.02
Formula C215H337N65O70S10
Sequence EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA

(Modifications: Disulfide bridges: 4-20, 12-25, 19-36, 27-34)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 158484-42-5
PubChem ID 90488781
InChI Key MBXCGHHUBOKUGG-UHFFFAOYSA-N
Smiles [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]4CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC5=CC=C(O)C=C5)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](NC1=O)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CNC5=C1C=CC=C5)C(=O)NCC(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N3)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC2=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N4)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets for ω-Agatoxin TK

Certificate of Analysis / Product Datasheet
Select another batch:

References for ω-Agatoxin TK

References are publications that support the biological activity of the product.

Teramoto et al (1997) A novel type of calcium channel sensitive to ω-agatoxin-TK in cultured rat cerebral cortical neurons. Brain Res. 756 225 PMID: 9187336

Barral et al (2001) High-affinity inhibition of glutamate release from corticostriatal synapses by ω-agatoxin TK. Eur.J.Pharmacol. 430 167 PMID: 11711028

Teramoto et al (1993) A novel peptide from funnel web spider venom, ω-Aga-TK, selectively blocks P-type calcium channels. Biochem.Biophys.Res.Comms. 196 134

View Related Products by Product Action

View all CaV2.x Channel Blockers

Keywords: w-Agatoxin TK, w-Agatoxin TK supplier, Ca2+, channel, blockers, P/Q-type, Calcium, CaV, Channels, P-Type, voltage-gated, voltage-dependent, Omega-Agatoxin, ω-Agatoxin, TK, w-AgatoxinTK, AgatoxinIVB, venoms, Agatoxin, IVB, Cav2.x, 2802, Tocris Bioscience

5 Citations for ω-Agatoxin TK

Citations are publications that use Tocris products. Selected citations for ω-Agatoxin TK include:

Grubb and Burrone (2010) Activity-dependent relocation of the axon initial segment fine-tunes neuronal excitability. Mol Cell Neurosci 465 1070 PMID: 20543823

Maier et al (2010) Sustained glutamate receptor activation down-regulates GABAB receptors by shifting the balance from recycling to lysosomal degradation. J Biol Chem 285 35606 PMID: 20826795

Fakira et al (2012) Purkinje cell dysfunction and delayed death in plasma membrane calcium ATPase 2-heterozygous mice. J Neurosci 51 22 PMID: 22789621

Cramer et al (2015) Abnormal excitability and episodic low-frequency oscillations in the cerebral cortex of the tottering mouse. Neuropsychopharmacology 35 5664 PMID: 25855180

Li et al (2011) Concurrent imaging of synaptic vesicle recycling and calcium dynamics. Front Mol Neurosci 4 34 PMID: 22065946


Reviews for ω-Agatoxin TK

Average Rating: 5 (Based on 1 Review.)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%

Have you used ω-Agatoxin TK?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Filter by:


Test of VGCCs input into 5HT-1B effect on transmembrane current.
By Sergiy Sylantyev on 12/10/2023
Assay Type: In Vitro
Species: Mouse
Cell Line/Tissue: Arcuate nucleus

1 μM omega -Agatoxin TK was used as a part of a mixture (also containing 1 μM omega -Conotoxin GVIA and 5 μM R-(+)-Bay-K) which blocks voltage-gated calcium channels in a living neuron membrane. Left: the effect of activation of 5HT-1B and AMPA receptors on transmembrane current evoked upon membrane depolarization. Blue trace: control; red trace: 5HT-1B and AMPA receptors activation. Right: block of VGCCs results in 100% suppression of transmembrane current.

PMID: 37827445
review image