Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit Reviewω-Agatoxin TK is a selective blocker of CaV2.1 P/Q-type calcium channels.
M. Wt | 5273.02 |
Formula | C215H337N65O70S10 |
Sequence |
EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA (Modifications: Disulfide bridges: 4-20, 12-25, 19-36, 27-34) |
Storage | Store at -20°C |
Purity | ≥95% (HPLC) |
CAS Number | 158484-42-5 |
PubChem ID | 90488781 |
InChI Key | MBXCGHHUBOKUGG-UHFFFAOYSA-N |
Smiles | [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]4CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC5=CC=C(O)C=C5)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](NC1=O)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CNC5=C1C=CC=C5)C(=O)NCC(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N3)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC2=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N4)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility | Soluble in water |
References are publications that support the biological activity of the product.
Teramoto et al (1997) A novel type of calcium channel sensitive to ω-agatoxin-TK in cultured rat cerebral cortical neurons. Brain Res. 756 225 PMID: 9187336
Barral et al (2001) High-affinity inhibition of glutamate release from corticostriatal synapses by ω-agatoxin TK. Eur.J.Pharmacol. 430 167 PMID: 11711028
Teramoto et al (1993) A novel peptide from funnel web spider venom, ω-Aga-TK, selectively blocks P-type calcium channels. Biochem.Biophys.Res.Comms. 196 134
If you know of a relevant reference for ω-Agatoxin TK, please let us know.
Keywords: w-Agatoxin TK, w-Agatoxin TK supplier, Ca2+, channel, blockers, P/Q-type, Calcium, CaV, Channels, P-Type, voltage-gated, voltage-dependent, Omega-Agatoxin, ω-Agatoxin, TK, w-AgatoxinTK, AgatoxinIVB, venoms, Agatoxin, IVB, Cav2.x, 2802, Tocris Bioscience
Citations are publications that use Tocris products. Selected citations for ω-Agatoxin TK include:
Maier et al (2010) Sustained glutamate receptor activation down-regulates GABAB receptors by shifting the balance from recycling to lysosomal degradation. J Biol Chem 285 35606 PMID: 20826795
Grubb and Burrone (2010) Activity-dependent relocation of the axon initial segment fine-tunes neuronal excitability. Mol Cell Neurosci 465 1070 PMID: 20543823
Fakira et al (2012) Purkinje cell dysfunction and delayed death in plasma membrane calcium ATPase 2-heterozygous mice. J Neurosci 51 22 PMID: 22789621
Cramer et al (2015) Abnormal excitability and episodic low-frequency oscillations in the cerebral cortex of the tottering mouse. Neuropsychopharmacology 35 5664 PMID: 25855180
Li et al (2011) Concurrent imaging of synaptic vesicle recycling and calcium dynamics. Front Mol Neurosci 4 34 PMID: 22065946
Do you know of a great paper that uses ω-Agatoxin TK from Tocris? Please let us know.
There are currently no reviews for this product. Be the first to review ω-Agatoxin TK and earn rewards!
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image