ω-Agatoxin TK

Pricing Availability   Qty
Description: CaV2.1 blocker
Alternative Names: Agatoxin IVB
Datasheet
Citations (5)
Reviews
Literature (3)

Biological Activity for ω-Agatoxin TK

ω-Agatoxin TK is a selective blocker of CaV2.1 P/Q-type calcium channels.

Technical Data for ω-Agatoxin TK

M. Wt 5273.02
Formula C215H337N65O70S10
Sequence EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA

(Modifications: Disulfide bridge between 4 - 20, 12 - 25, 19 - 36, 27 - 34)

Storage Desiccate at -20°C
CAS Number 158484-42-5
PubChem ID 90488781
InChI Key MBXCGHHUBOKUGG-UHFFFAOYSA-N
Smiles [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]4CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC5=CC=C(O)C=C5)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](NC1=O)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CNC5=C1C=CC=C5)C(=O)NCC(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N3)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC2=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N4)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for ω-Agatoxin TK

Solubility Soluble in water

Product Datasheets for ω-Agatoxin TK

Certificate of Analysis / Product Datasheet
Select another batch:

References for ω-Agatoxin TK

References are publications that support the biological activity of the product.

Teramoto et al (1997) A novel type of calcium channel sensitive to ω-agatoxin-TK in cultured rat cerebral cortical neurons. Brain Res. 756 225 PMID: 9187336

Barral et al (2001) High-affinity inhibition of glutamate release from corticostriatal synapses by ω-agatoxin TK. Eur.J.Pharmacol. 430 167 PMID: 11711028

Teramoto et al (1993) A novel peptide from funnel web spider venom, ω-Aga-TK, selectively blocks P-type calcium channels. Biochem.Biophys.Res.Comms. 196 134


If you know of a relevant reference for ω-Agatoxin TK, please let us know.

View Related Products by Product Action

View all CaV2.x Channel Blockers

Keywords: w-Agatoxin TK, w-Agatoxin TK supplier, Ca2+, channel, blockers, P/Q-type, Calcium, CaV, Channels, P-Type, voltage-gated, voltage-dependent, Omega-Agatoxin, ω-Agatoxin, TK, w-AgatoxinTK, AgatoxinIVB, venoms, Agatoxin, IVB, Cav2.x, 2802, Tocris Bioscience

5 Citations for ω-Agatoxin TK

Citations are publications that use Tocris products. Selected citations for ω-Agatoxin TK include:

Fakira et al (2012) Purkinje cell dysfunction and delayed death in plasma membrane calcium ATPase 2-heterozygous mice. J Neurosci 51 22 PMID: 22789621

Maier et al (2010) Sustained glutamate receptor activation down-regulates GABAB receptors by shifting the balance from recycling to lysosomal degradation. J Biol Chem 285 35606 PMID: 20826795

Grubb and Burrone (2010) Activity-dependent relocation of the axon initial segment fine-tunes neuronal excitability. Mol Cell Neurosci 465 1070 PMID: 20543823

Li et al (2011) Concurrent imaging of synaptic vesicle recycling and calcium dynamics. Front Mol Neurosci 4 34 PMID: 22065946


Do you know of a great paper that uses ω-Agatoxin TK from Tocris? Please let us know.

Reviews for ω-Agatoxin TK

There are currently no reviews for this product. Be the first to review ω-Agatoxin TK and earn rewards!

Have you used ω-Agatoxin TK?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Ion Channel Product Listing

Ion Channel Product Listing

A collection of around 500 products for ion channel research, the listing includes research tools for the study of:

  • Ligand-gated ion channels
  • Voltage-gated ion channels
  • Other Ion Channels
Neurotransmission Product Guide

Neurotransmission Product Guide

A collection of over 250 products for neurotransmission research, the guide includes research tools for the study of:

  • Dopaminergic Transmission
  • Glutamatergic Transmission
  • Opioid Peptide Transmission
  • Serotonergic Transmission
  • Chemogenetics
Pain Research Product Guide

Pain Research Product Guide

A collection of over 280 products for pain research, the guide includes research tools for the study of:

  • Nociception
  • Ion Channels
  • G-Protein-Coupled Receptors
  • Intracellular Signaling