ω-Agatoxin IVA

Pricing Availability Delivery Time Qty
Cat.No. 2799 - w-Agatoxin IVA | Lys-Lys-Lys-Cys-Ile-Ala-Lys-Asp-Tyr-Gly-Arg-Cys-Lys-Trp-Gly-Gly-Thr-Pro-Cys-Cys-Arg-Gly-Arg-Gly-Cys-Ile-Cys-Ser-Ile-Met-Gly-Thr-Asn-Cys-Glu-Cys-Lys-Pro-Arg-Leu-Ile-Met-Glu-Gly-Leu-Gly-Leu-Ala (Disulfide bridge: C4-C20,C12-C25,C19-C36,C27-34) | CAS No. 145017-83-0
Description: Ca2+ channel blocker (P-type)
Alternative Names: ω-Aga-IV A
Datasheet
Citations (4)
Literature

Biological Activity

Selective blocker of P-type calcium channels (IC50 < 1 - 3 nM). Also inhibits N-type channels at micromolar concentrations.

Technical Data

M. Wt 5202.25
Formula C217H360N68O60S10
Sequence KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

(Modifications: Disulfide bridge between 4 - 20, 12 - 25, 19 - 36, 27 - 34)

Storage Desiccate at -20°C
CAS Number 145017-83-0
PubChem ID 56841669
InChI Key NVVFOMZVLALQKT-JYRRICCISA-N
Smiles [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]4CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CC5=CC=C(O)C=C5)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@@H](NC1=O)[C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC5=C1C=CC=C5)C(=O)NCC(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N3)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC2=O)[C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N4)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

All Tocris products are intended for laboratory research use only.

Solubility Data

SolubilitySoluble in water

Preparing Stock Solutions

The following data is based on the product molecular weight 5202.25. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.

Select a batch to recalculate based on the batch molecular weight:
Concentration / Solvent Volume / Mass 1 mg 5 mg 10 mg
1 mM 0.19 mL 0.96 mL 1.92 mL
5 mM 0.04 mL 0.19 mL 0.38 mL
10 mM 0.02 mL 0.1 mL 0.19 mL
50 mM 0 mL 0.02 mL 0.04 mL

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Dilution Calculator

Calculate the dilution required to prepare a stock solution.
x
=
x

Product Datasheets

Certificate of Analysis / Product Datasheet
Select another batch:
Safety Datasheet

References

References are publications that support the products' biological activity.

Mintz et al (1992) P-type calcium channels blocked by the spider toxin ω-Aga-IVA. Nature 355 827 PMID: 1311418

Turner et al (1992) Calcium channels coupled to glutamate release identified by ω-Aga-IVA. Science 258 310 PMID: 1357749

Bourinet et al (1999) Splicing of α1A subunit gene generates phenotypic variants of P- and Q-type calcium channels. Nat.Neurosci. 2 407 PMID: 10321243

Tringham et al (2008) Protease treatment of cerebellar purkinje cells renders ω-agatoxin IVA-sensitive Ca2+ channels insensitive to inhibition by ω-conotoxin GVIA. J.Pharmacol.Exp.Ther. 324 806 PMID: 17975010


If you know of a relevant reference for ω-Agatoxin IVA, please let us know.

View Related Products by Product Action

View all Voltage-gated Calcium Channel (CaV) Blockers

Keywords: w-Agatoxin IVA, supplier, Ca2+, channel, blockers, P-type, Calcium, CaV, Channels, voltage-gated, voltage-dependent, ω-Agatoxin, omega-Agatoxin, IVA, w-AgatoxinIVA, w-Aga-IVA, ω-Aga-IVA, venoms, w-Aga-IV, A, Voltage-gated, Calcium, Channels, Tocris Bioscience

4 Citations for ω-Agatoxin IVA

Citations are publications that use Tocris products. Selected citations for ω-Agatoxin IVA include:

Bellono (2017) Molecular basis of ancestral vertebrate electroreception. Nature 543 391 PMID: 28264196

Medrihan et al (2013) Synapsin II desynchronizes neurotransmitter release at inhibitory synapses by interacting with presynaptic calcium channels. Nature 4 1512 PMID: 23443540

Jiang et al (2010) The maturation of GABAergic transmission in visual cortex requires endocannabinoid-mediated LTD of inhibitory inputs during a critical period. Neuron 66 248 PMID: 20435001

Higley and Sabatini (2010) Competitive regulation of synaptic Ca2+ influx by D2 dopamine and A2A adenosine receptors. Nat Neurosci 13 958 PMID: 20601948


Do you know of a great paper that uses ω-Agatoxin IVA from Tocris? If so please let us know.

Commented out for usability testing

Reviews

TODO: Add Reviews

Literature in this Area

Cardiovascular

Cardiovascular Research Product Guide

A collection of over 250 products for cardiovascular research, the guide includes research tools for the study of:

  • Hypertension
  • Thrombosis and Hemostasis
  • Atherosclerosis
  • Myocardial Infarction
  • Ischemia/Reperfusion Injury
  • Arrhythmias
  • Heart Failure
Pain

Pain Research Product Guide

A collection of over 250 products for pain research, the guide includes research tools for the study of:

  • Nociception
  • Ion Channels
  • G-Protein-Coupled Receptors
  • Intracellular Signaling
Depression

Depression Poster

Major depressive disorder is characterized by depressed mood and a loss of interest and/or pleasure. Updated in 2015 this poster highlights presynaptic and postsynaptic targets for the potential treatment of major depressive disorder, as well as outlining the pharmacology of currently approved antidepressant drugs.

Pathways for ω-Agatoxin IVA

Protocols

TODO: Add Protocols