SNX 482

Discontinued Product

2945 has been discontinued.

View all Ca<sub>V</sub>2.x Channels products.
Description: Potent and selective CaV2.3 blocker
Datasheet
Citations (7)
Reviews

Biological Activity for SNX 482

SNX 482 is a potent and selective, voltage-dependent R-type CaV2.3 calcium channel blocker (IC50 = 30 nM). Antinociceptive; inhibits nociceptive C-fibre and Aδ-fibre-evoked neuronal responses.

Technical Data for SNX 482

M. Wt 4495.01
Formula C192H274N52O60S7
Sequence GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD

(Modifications: Disulfide bridge between 7 - 21, 14 - 26, 20 - 33)

Storage Desiccate at -20°C
CAS Number 203460-30-4
PubChem ID 90488787
InChI Key NSUPRLHDCFNOKD-UHFFFAOYSA-N
Smiles [H]NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CC=C(O)C=C4)NC(=O)[C@H](CO)NC(=O)[C@H](CC4=CC=CC=C4)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CC4=CNC=N4)NC(=O)[C@H](CSSC[C@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC4=CC=CC=C4)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC4=CC=C(O)C=C4)NC(=O)[C@H](CCCNC(N)=N)NC1=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N3)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]1CCCN1C2=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets for SNX 482

Certificate of Analysis / Product Datasheet
Select another batch:

References for SNX 482

References are publications that support the biological activity of the product.

Newcomb et al (1998) Selective peptide antagonist of the class E calcium channel from the venom of the Tarantula Hysterocrates gigas. Biochemistry 37 15353 PMID: 9799496

Bourinet et al (2001) Interaction of SNX482 with domains III and IV inhibits activation gating of α1E (CaV2.3) calcium channels. Biophys.J. 81 79 PMID: 11423396

Matthews et al (2007) The CaV2.3 calcium channel antagonist SNX-482 reduces dorsal horn neuronal responses in a rat model of chronic neuropathic pain. Eur.J.Neurosci. 25 3561 PMID: 17610575

View Related Products by Product Action

View all CaV2.x Channel Blockers

Keywords: SNX 482, SNX 482 supplier, Potent, selective, CaV23, blockers, R-type, Calcium, CaV, Channels, R-Type, voltage-gated, voltage-dependent, Ca2+, SNX482, venoms, Cav2.x, 2945, Tocris Bioscience

7 Citations for SNX 482

Citations are publications that use Tocris products. Selected citations for SNX 482 include:

Pan et al (2014) σ-1 receptor antagonism restores injury-induced decrease of voltage-gated Ca2+ current in sensory neurons. Proc Natl Acad Sci U S A 350 290 PMID: 24891452

Hashiguchi (2017) Direct versus indirect actions of ghrelin on hypothalamic NPY neurons. PLoS One 12 e0184261 PMID: 28877214

Goswami et al (2012) Miniature IPSCs in hippocampal granule cells are triggered by voltage-gated Ca2+ channels via microdomain coupling. J Neurosci 32 14294 PMID: 23055500

Brennan et al (2013) Fetal calcium regulates branching morphogenesis in the developing human and mouse lung: involvement of voltage-gated calcium channels. PLoS One 8 e80294 PMID: 24282533


Reviews for SNX 482

There are currently no reviews for this product. Be the first to review SNX 482 and earn rewards!

Have you used SNX 482?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review