SNX 482

Discontinued Product

2945 has been discontinued.

View all Ca<sub>V</sub>2.x Channels products.
Description: Potent and selective CaV2.3 blocker
Datasheet
Citations (7)
Reviews

Biological Activity for SNX 482

SNX 482 is a potent and selective, voltage-dependent R-type CaV2.3 calcium channel blocker (IC50 = 30 nM). Antinociceptive; inhibits nociceptive C-fibre and Aδ-fibre-evoked neuronal responses.

Technical Data for SNX 482

M. Wt 4495.01
Formula C192H274N52O60S7
Sequence GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD

(Modifications: Disulfide bridge between 7 - 21, 14 - 26, 20 - 33)

Storage Desiccate at -20°C
CAS Number 203460-30-4
PubChem ID 90488787
InChI Key NSUPRLHDCFNOKD-UHFFFAOYSA-N
Smiles [H]NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CC=C(O)C=C4)NC(=O)[C@H](CO)NC(=O)[C@H](CC4=CC=CC=C4)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CC4=CNC=N4)NC(=O)[C@H](CSSC[C@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC4=CC=CC=C4)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC4=CC=C(O)C=C4)NC(=O)[C@H](CCCNC(N)=N)NC1=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N3)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]1CCCN1C2=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets for SNX 482

Certificate of Analysis / Product Datasheet
Select another batch:

References for SNX 482

References are publications that support the biological activity of the product.

Newcomb et al (1998) Selective peptide antagonist of the class E calcium channel from the venom of the Tarantula Hysterocrates gigas. Biochemistry 37 15353 PMID: 9799496

Bourinet et al (2001) Interaction of SNX482 with domains III and IV inhibits activation gating of α1E (CaV2.3) calcium channels. Biophys.J. 81 79 PMID: 11423396

Matthews et al (2007) The CaV2.3 calcium channel antagonist SNX-482 reduces dorsal horn neuronal responses in a rat model of chronic neuropathic pain. Eur.J.Neurosci. 25 3561 PMID: 17610575

View Related Products by Product Action

View all CaV2.x Channel Blockers

Keywords: SNX 482, SNX 482 supplier, Potent, selective, CaV23, blockers, R-type, Calcium, CaV, Channels, R-Type, voltage-gated, voltage-dependent, Ca2+, SNX482, venoms, Cav2.x, 2945, Tocris Bioscience

7 Citations for SNX 482

Citations are publications that use Tocris products. Selected citations for SNX 482 include:

Brennan et al (2013) Fetal calcium regulates branching morphogenesis in the developing human and mouse lung: involvement of voltage-gated calcium channels. PLoS One 8 e80294 PMID: 24282533

Grubb and Burrone (2010) Activity-dependent relocation of the axon initial segment fine-tunes neuronal excitability. J Pharmacol Exp Ther 465 1070 PMID: 20543823

Higley and Sabatini (2010) Competitive regulation of synaptic Ca2+ influx by D2 DA and A2A adenosine receptors. Nat Neurosci 13 958 PMID: 20601948

Smith et al (2018) Calcium Channel CaV2.3 Subunits Regulate Hepatic Glucose Production by Modulating Leptin-Induced Excitation of Arcuate Pro-opiomelanocortin Neurons. Cell Rep 25 278 PMID: 30304668


Reviews for SNX 482

There are currently no reviews for this product. Be the first to review SNX 482 and earn rewards!

Have you used SNX 482?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review