Peptide YY (3-36) human

Discontinued Product

Peptide YY (3-36) human (Cat. No. 6288) has been withdrawn from sale for commercial reasons.
Description: NPY Y2 receptor agonist
Purity: ≥95% (HPLC)
Datasheet
Citations
Reviews
Literature (1)

Biological Activity for Peptide YY (3-36) human

Peptide YY (3-36) human is a NPY Y2 receptor agonist. Peripheral administration inhibits food intake in mice. This effect is greater when Peptide YY (3-36) is administered in combination with GLP-1 (7-36) (Cat.No. 2082).

Technical Data for Peptide YY (3-36) human

M. Wt 4049.51
Formula C180H279N53O54
Sequence IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY

(Modifications: Tyr-34 = C-terminal amide)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 123583-37-9
PubChem ID 71581482
InChI Key AUHJXHCVECGTKR-RIBGVNDISA-N
Smiles [H]N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets for Peptide YY (3-36) human

Certificate of Analysis / Product Datasheet
Select another batch:

References for Peptide YY (3-36) human

References are publications that support the biological activity of the product.

Batterham et al (2002) Gut hormone PYY(3-36) physiologically inhibits food intake. Nature 418 650 PMID: 12167864

Neary et al (2005) Peptide YY3-36 and glucagon-like peptide-17-36 inhibit food intake additively Endocrinology. 146 5120 PMID: 16150917

View Related Products by Target

View Related Products by Product Action

View all NPY Receptor Agonists

Keywords: Peptide YY (3-36) human, Peptide YY (3-36) human supplier, Peptide, YY, human, neuropeptide, Y2, NPY, receptor, PYY, agonists, agonism, Receptors, 6288, Tocris Bioscience

Citations for Peptide YY (3-36) human

Citations are publications that use Tocris products.

Currently there are no citations for Peptide YY (3-36) human.

Reviews for Peptide YY (3-36) human

There are currently no reviews for this product. Be the first to review Peptide YY (3-36) human and earn rewards!

Have you used Peptide YY (3-36) human?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Peptides Involved in Appetite Modulation Scientific Review

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.