Glucagon-like peptide 1 (7-36) amide (human, rat)

Pricing Availability   Qty

Save 26% on Select RUO Reagents. See Details

Description: Potent insulinotropic peptide
Alternative Names: GLP-1 (7-36) amide
Purity: ≥95% (HPLC)
Datasheet
Citations
Reviews
Literature (1)

Biological Activity

Glucagon-like peptide 1 (7-36) amide (human, rat) is a potent glucose-dependent insulinotropic peptide produced by post-translational processing of proglucagon in intestinal L-cells. Displays high affinity for GLP-1 receptors expressed in rat insulinoma-derived RINm5F cells (Kd = 204 pM). Stimulates insulin gene transcription and secretion in pancreatic β-cells. Displays antiapoptotic effects in hippocampal neurons and reduces food intake in fasted rats following central administration.

Technical Data

M. Wt 3297.67
Formula C149H226N40O45
Sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR

(Modifications: Arg-30 = C-terminal amide)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 107444-51-9
PubChem ID 16133831
InChI Key DTHNMHAUYICORS-KTKZVXAJSA-N
Smiles [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data

Solubility Soluble to 1 mg/ml in water

Product Datasheets

Certificate of Analysis / Product Datasheet
Select another batch:

References

References are publications that support the biological activity of the product.

Goke and Conlon (1988) Receptors for glucagon-like peptide-1(7-37) amide on rat Insoma-derived cells. J.Endocrinol. 116 357 PMID: 2832504

Turton et al (1996) A role for glucagon-like peptide-1 in the central regulation of feeding. Nature 379 69 PMID: 8538742

Perfetti and Merkel (2000) Glucagon-like peptide-1: a major regulator of pancreatic β-cell function. Eur.J.Endocrinol. 143 717 PMID: 11124853

Perry et al (2002) Protection and reversal of excitotoxic neuronal damage by glucagon-like peptide-1 and exendin-4. J.Pharmacol.Exp.Ther. 302 881 PMID: 12183643


If you know of a relevant reference for Glucagon-like peptide 1 (7-36) amide (human, rat), please let us know.

View Related Products by Product Action

View all Glucagon-Like Peptide 1 Receptor Agonists

Keywords: Glucagon-like peptide 1 (7-36) amide (human, rat), Glucagon-like peptide 1 (7-36) amide (human, rat) supplier, Potent, insulinotropic, peptide, GLP-1, Receptors, Glucagon-Like, Peptide, 1, Glucagon-like, peptide1, (7-36), amide, (human, rat), GLP1(7-36), 2082, Tocris Bioscience

Citations for Glucagon-like peptide 1 (7-36) amide (human, rat)

Citations are publications that use Tocris products.

Currently there are no citations for Glucagon-like peptide 1 (7-36) amide (human, rat). Do you know of a great paper that uses Glucagon-like peptide 1 (7-36) amide (human, rat) from Tocris? Please let us know.

Reviews for Glucagon-like peptide 1 (7-36) amide (human, rat)

There are currently no reviews for this product. Be the first to review Glucagon-like peptide 1 (7-36) amide (human, rat) and earn rewards!

Have you used Glucagon-like peptide 1 (7-36) amide (human, rat)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Peptides Involved in Appetite Modulation Scientific Review

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.