PACAP 1-38

Pricing Availability   Qty
Cat.No. 1186 - PACAP 1-38 | His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2 | CAS No. 137061-48-4
Description: Potent stimulator of adenylyl cyclase
Alternative Names: Pituitary Adenylate Cyclase-Activating Polypeptide 1-38
Datasheet
Citations (3)
Reviews
Literature (2)

Biological Activity

Endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP) but with a greater potency for stimulation of adenylyl cyclase.

Technical Data

M. Wt 4535
Formula C203H331N63O53S
Sequence HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK

(Modifications: Lys-38 = C-terminal amide)

Storage Desiccate at -20°C
CAS Number 137061-48-4
PubChem ID 44566111
InChI Key UFTCZKMBJOPXDM-XXFCQBPRSA-N
Smiles [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data

Solubility Soluble to 0.90 mg/ml in water

Product Datasheets

Certificate of Analysis / Product Datasheet
Select another batch:

View Related Products by Product Action

View all PACAP Receptor Agonists

Keywords: PACAP 1-38, PACAP 1-38 supplier, Potently, stimulates, adenylyl, cyclases, stimulator, adenylate, Inositol, cAMP, Signaling, Signalling, Pituitary, Adenylate, Activating, Peptide, Receptors, PAC1, PACAP138, Cyclase-Activating, Polypeptide, 1-38, PACAP, Adenylyl, Cyclase, 1186, Tocris Bioscience

3 Citations for PACAP 1-38

Citations are publications that use Tocris products. Selected citations for PACAP 1-38 include:

Sakamoto et al (2015) Pituitary adenylate cyclase-activating polypeptide protects glomerular podocytes from inflammatory injuries. J Diabetes Res 2015 727152 PMID: 25821833

Xiao et al (2019) PACAP ameliorates hepatic metabolism and inflammation through up-regulating FAIM in obesity. J Cell Mol Med PMID: 31270932

Nostramo et al (2012) Regulation of angiotensin II type 2 receptor gene expression in the adrenal medulla by acute and repeated immobilization stress. J Cereb Blood Flow Metab 215 291 PMID: 22911895


Do you know of a great paper that uses PACAP 1-38 from Tocris? Please let us know.

Reviews for PACAP 1-38

There are currently no reviews for this product. Be the first to review PACAP 1-38 and earn rewards!

Have you used PACAP 1-38?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* or download your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


GPCR

GPCR Product Listing

A collection of over 450 products for G protein-coupled receptors, the listing includes research tools for the study of:

  • Rhodopsin-like Receptors
  • Glutamate Receptors
  • Frizzled Receptors
  • GPCR Signaling
Peptide Hormone Receptors

Peptide Hormone Receptors Product Listing

A collection of over 200 products for peptide hormone receptors, the listing includes research tools for the study of:

  • Anterior Pituitary Regulation
  • Blood Pressure Regulation
  • Feeding and Appetite Regulation
  • Glucose Regulation
  • Peptide Hormone Processing