Margatoxin

Pricing Availability   Qty
Description: Potent KV1.3 channel blocker
Alternative Names: MgTX
Purity: ≥95% (HPLC)
Datasheet
Citations
Reviews (1)
Literature (5)

Biological Activity for Margatoxin

Margatoxin is a potent KV1.3 channel blocker (IC50 = 36 pM). Displays no effect at calcium-activated channels. Reduces VEGF-induced transmembrane calcium influxes and nitric oxide production in human endothelial cells.

Technical Data for Margatoxin

M. Wt 4178.96
Formula C178H286N52O50S7
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH

(Modifications: Disulfide bridges: 7-29, 13-34, 17-36)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 145808-47-5
PubChem ID 121596045
InChI Key OVJBOPBBHWOWJI-FYNXUGHNSA-N
Smiles [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CC3=CC=CC=C3)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]4CCCN4C(=O)[C@H](CO)NC(=O)[C@@H](NC1=O)[C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N3)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC2=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CNC=N1)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for Margatoxin

Solubility Soluble to 0.50 mg/ml in water

Product Datasheets for Margatoxin

Certificate of Analysis / Product Datasheet
Select another batch:

References for Margatoxin

References are publications that support the biological activity of the product.

Garcia-Calvo et al (1993) Purification, characterization, and biosynthesis of Margatoxin, a component of Centruroides margaritatus venom that selectively inhibits voltage-dependent potassium channels. J.Biol.Chem. 268 18866 PMID: 8360176

Erdogan et al (2005) Margatoxin inhibits VEGF-induced hyperpolarization, proliferation and nitric oxide production of human endothelial cells. J.Vasc.Res. 42 368 PMID: 16043967


If you know of a relevant reference for Margatoxin, please let us know.

View Related Products by Product Action

View all Voltage-gated Potassium (KV) Channel Blockers

Keywords: Margatoxin, Margatoxin supplier, Kv1.3, channel, blocker, voltage-gated, potassium, channels, MgTX, MTX, venoms, Voltage-Gated, Potassium, Channels, 3563, Tocris Bioscience

Citations for Margatoxin

Citations are publications that use Tocris products.

Currently there are no citations for Margatoxin. Do you know of a great paper that uses Margatoxin from Tocris? Please let us know.

Reviews for Margatoxin

Average Rating: 5 (Based on 1 Review.)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%

Have you used Margatoxin?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Filter by:


Great water soluble selective Kv channel blocker.
By Anonymous on 10/15/2018
Assay Type: In Vitro
Species: Human

Margatoxin was used in our lab to study SK channel opening and blocking effect. Margatoxin was used to compare with other selective SK channel blockers as they do not show significant SK blocking. The product performed excellent in sterile cell culture labs and would high recommend. The product is water soluble which is also a plus.

review image

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Cardiovascular Research Product Guide

Cardiovascular Research Product Guide

A collection of over 250 products for cardiovascular research, the guide includes research tools for the study of:

  • Hypertension
  • Thrombosis and Hemostasis
  • Atherosclerosis
  • Myocardial Infarction
  • Ischemia/Reperfusion Injury
  • Arrhythmias
  • Heart Failure
Ion Channel Product Listing

Ion Channel Product Listing

A collection of around 500 products for ion channel research, the listing includes research tools for the study of:

  • Ligand-gated ion channels
  • Voltage-gated ion channels
  • Other Ion Channels
Pain Research Product Guide

Pain Research Product Guide

A collection of over 280 products for pain research, the guide includes research tools for the study of:

  • Nociception
  • Ion Channels
  • G-Protein-Coupled Receptors
  • Intracellular Signaling
Epilepsy Poster

Epilepsy Poster

Epilepsy is a brain disease that affects 60 million people globally. More than 20 anti-seizure drugs are currently available, but these do not address the underlying causes of the condition. This poster summarizes current knowledge about the development of the condition and highlights some approaches that have disease-modifying effects in proof-of-concept studies.

Pain Poster

Pain Poster

Peripheral sensitization is the reduction in the threshold of excitability of sensory neurons that results in an augmented response to a given external stimulus. This poster outlines the excitatory and inhibitory signaling pathways involved in modulation of peripheral sensitization. The role of ion channels, GPCRs, neurotrophins, and cytokines in sensory neurons are also described.