Klotho-derived peptide 6

Pricing Availability   Qty

Save Up to 35% on Select RUO Reagents. See Details

Description: Wnt/β-catenin signaling inhibitor
Purity: ≥90% (HPLC)
Datasheet
Citations
Reviews
Pathways (1)

Biological Activity for Klotho-derived peptide 6

Klotho-derived peptide 6 is a β-catenin signaling inhibitor. Binds to and sequesters Wnt ligands in vitro; prevents expression of Wnt1-induced fibronectin and α-smooth muscle action. In an in vivo mouse model of diabetic kidney disease, Klotho-derived peptide 6 reduces kidney injury, improves survival and prevents accumulation of fibronectin and collagen IV in glomeruli.

Technical Data for Klotho-derived peptide 6

M. Wt 3491.87
Formula C159H232N46O44
Sequence QPVVTLYHWDLPQRLQDAYGGWANRALADH
Storage Store at -20°C
Purity ≥90% (HPLC)
CAS Number 2102414-23-1
InChI Key BQDMNXDIAPCSQW-XCQHBGKYSA-N
Smiles O=C(N1[C@@H](CCC1)C(N[C@@H](C(C)C)C(N[C@@H](C(C)C)C(N[C@@H]([C@H](O)C)C(N[C@@H](CC(C)C)C(N[C@@H](CC2=CC=C(C=C2)O)C(N[C@@H](CC3=CNC=N3)C(N[C@@H](CC4=CNC5=CC=CC=C45)C(N[C@@H](CC(O)=O)C(N[C@@H](CC(C)C)C(N6[C@@H](CCC6)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(C)C)C(N[C@@H](CCC(N)=O)C(N[C@@H](CC(O)=O)C(N[C@@H](C)C(N[C@@H](CC7=CC=C(C=C7)O)C(NCC(NCC(N[C@@H](CC8=CNC9=CC=CC=C89)C(N[C@@H](C)C(N[C@@H](CC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](C)C(N[C@@H](CC(C)C)C(N[C@@H](C)C(N[C@@H](CC(O)=O)C(N[C@@H](CC%10=CNC=N%10)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CCC(N)=O)N

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for Klotho-derived peptide 6

Solubility Soluble to 1 mg/ml in water

Product Datasheets for Klotho-derived peptide 6

References for Klotho-derived peptide 6

References are publications that support the biological activity of the product.

Chen et al (2022) Klotho-derived peptide 6 ameliorates diabetic kidney disease by targeting Wnt/β-catenin signaling. Kidney Int. 102 506 PMID: 35644285


If you know of a relevant reference for Klotho-derived peptide 6, please let us know.

View Related Products by Target

View Related Products by Product Action

View all β-catenin Inhibitors

Keywords: Klotho-derived peptide 6, Klotho-derived peptide 6 supplier, klothoderived, peptide6, inhibitors, inhibitor, kidney, beta, catenin, signaling, b-catenin, klotho, KP6, wnt, ligand, Beta-catenin, 7847, Tocris Bioscience

Citations for Klotho-derived peptide 6

Citations are publications that use Tocris products.

Currently there are no citations for Klotho-derived peptide 6. Do you know of a great paper that uses Klotho-derived peptide 6 from Tocris? Please let us know.

Reviews for Klotho-derived peptide 6

There are currently no reviews for this product. Be the first to review Klotho-derived peptide 6 and earn rewards!

Have you used Klotho-derived peptide 6?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Pathways for Klotho-derived peptide 6

Wnt Signaling Pathway

Wnt Signaling Pathway

The Wnt pathway is involved in cellular differentiation and proliferation in adult tissues and also during embryogenesis. Disturbances within the pathway may lead to the formation of tumors and promote metastasis.