Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewKlotho-derived peptide 6 is a β-catenin signaling inhibitor. Binds to and sequesters Wnt ligands in vitro; prevents expression of Wnt1-induced fibronectin and α-smooth muscle action. In an in vivo mouse model of diabetic kidney disease, Klotho-derived peptide 6 reduces kidney injury, improves survival and prevents accumulation of fibronectin and collagen IV in glomeruli.
| M. Wt | 3491.87 |
| Formula | C159H232N46O44 |
| Sequence | QPVVTLYHWDLPQRLQDAYGGWANRALADH |
| Storage | Store at -20°C |
| Purity | ≥90% (HPLC) |
| CAS Number | 2102414-23-1 |
| InChI Key | BQDMNXDIAPCSQW-XCQHBGKYSA-N |
| Smiles | O=C(N1[C@@H](CCC1)C(N[C@@H](C(C)C)C(N[C@@H](C(C)C)C(N[C@@H]([C@H](O)C)C(N[C@@H](CC(C)C)C(N[C@@H](CC2=CC=C(C=C2)O)C(N[C@@H](CC3=CNC=N3)C(N[C@@H](CC4=CNC5=CC=CC=C45)C(N[C@@H](CC(O)=O)C(N[C@@H](CC(C)C)C(N6[C@@H](CCC6)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(C)C)C(N[C@@H](CCC(N)=O)C(N[C@@H](CC(O)=O)C(N[C@@H](C)C(N[C@@H](CC7=CC=C(C=C7)O)C(NCC(NCC(N[C@@H](CC8=CNC9=CC=CC=C89)C(N[C@@H](C)C(N[C@@H](CC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](C)C(N[C@@H](CC(C)C)C(N[C@@H](C)C(N[C@@H](CC(O)=O)C(N[C@@H](CC%10=CNC=N%10)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CCC(N)=O)N |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
| Solubility | Soluble to 1 mg/ml in water |
References are publications that support the biological activity of the product.
Chen et al (2022) Klotho-derived peptide 6 ameliorates diabetic kidney disease by targeting Wnt/β-catenin signaling. Kidney Int. 102 506 PMID: 35644285
If you know of a relevant reference for Klotho-derived peptide 6, please let us know.
Keywords: Klotho-derived peptide 6, Klotho-derived peptide 6 supplier, klothoderived, peptide6, inhibitors, inhibitor, kidney, beta, catenin, signaling, b-catenin, klotho, KP6, wnt, ligand, Beta-catenin, 7847, Tocris Bioscience
Citations are publications that use Tocris products.
Currently there are no citations for Klotho-derived peptide 6. Do you know of a great paper that uses Klotho-derived peptide 6 from Tocris? Please let us know.
There are currently no reviews for this product. Be the first to review Klotho-derived peptide 6 and earn rewards!
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image