Kaliotoxin

Pricing Availability Delivery Time Qty
Cat.No. 3564 - Kaliotoxin | Gly-Val-Glu-Ile-Asn-Val-Lys-Cys-Ser-Gly-Ser-Pro-Gln-Cys-Leu-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-His-Cys-Thr-Pro-Lys(Disulfide bridges: 8 - 28, 14 - 33, 18 - 35) | CAS No. 145199-73-1
Description: KV and KCa blocker
Datasheet
Citations
Literature

Biological Activity

Potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1 and 25 nM for KV1.3, KV1.1 and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels.

Technical Data

M. Wt 4149.94
Formula C171H283N55O49S8
Sequence GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK

(Modifications: Disulfide bridge between 8 - 28, 14 - 33, 18 - 35)

Storage Store at -20°C
CAS Number 145199-73-1
PubChem ID 42601487
InChI Key SKSKHLKOZPRFOV-GFCGCHFTSA-N
Smiles [H]NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC3=CC=CC=C3)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCSC)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CNC=N4)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]4CCCN4C(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CO)NC1=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N3)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC2=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

All Tocris products are intended for laboratory research use only.

Solubility Data

SolubilitySoluble to 2 mg/ml in water

Preparing Stock Solutions

The following data is based on the product molecular weight 4149.94. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.

Select a batch to recalculate based on the batch molecular weight:
Concentration / Solvent Volume / Mass 1 mg 5 mg 10 mg
1 mM 0.24 mL 1.2 mL 2.41 mL
5 mM 0.05 mL 0.24 mL 0.48 mL
10 mM 0.02 mL 0.12 mL 0.24 mL
50 mM 0 mL 0.02 mL 0.05 mL

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Dilution Calculator

Calculate the dilution required to prepare a stock solution.
x
=
x

Product Datasheets

Safety Datasheet

References

References are publications that support the products' biological activity.

Romi et al (1993) Synthesis and characterization of kaliotoxin: is the 26-32 sequence essential for potassium channel recognition? J.Biol.Chem. 268 26302 PMID: 8253752

Mourre et al (1999) Distribution in rat brain of binding sites of kaliotoxin, a blocker of Kv1.1and Kv1.3 α-subunits. J.Pharmacol.Exp.Ther. 291 943 PMID: 10565809

Korukottu et al (2008) High-resolution 3D structure determination of kaliotoxin by solid-state NMR spectroscopy. PLoS ONE 3 e2359 PMID: 18523586


If you know of a relevant reference for Kaliotoxin, please let us know.

View Related Products by Product Action

View all Voltage-gated Potassium (KV) Channel Blockers

Keywords: Kaliotoxin, supplier, potassium, channels, blockers, ca2+-activated, voltage, sensitive, gated, K+, venoms, Voltage-Gated, Potassium, Channels, Tocris Bioscience

Citations for Kaliotoxin

Citations are publications that use Tocris products.

Currently there are no citations for Kaliotoxin. Do you know of a great paper that uses Kaliotoxin from Tocris? If so please let us know.

Commented out for usability testing

Reviews

TODO: Add Reviews

Literature in this Area

Cardiovascular

Cardiovascular Research Product Guide

A collection of over 250 products for cardiovascular research, the guide includes research tools for the study of:

  • Hypertension
  • Thrombosis and Hemostasis
  • Atherosclerosis
  • Myocardial Infarction
  • Ischemia/Reperfusion Injury
  • Arrhythmias
  • Heart Failure
Pain

Pain Research Product Guide

A collection of over 250 products for pain research, the guide includes research tools for the study of:

  • Nociception
  • Ion Channels
  • G-Protein-Coupled Receptors
  • Intracellular Signaling
Pain

Pain Poster

Peripheral sensitization is the reduction in the threshold of excitability of sensory neurons that results in an augmented response to a given external stimulus. This poster outlines the excitatory and inhibitory signaling pathways involved in modulation of peripheral sensitization. The role of ion channels, GPCRs, neurotrophins, and cytokines in sensory neurons are also described.

Pathways for Kaliotoxin

Protocols

TODO: Add Protocols