Home / Pharmacology / Ion Channels / Potassium Channels / Voltage-gated Potassium (KV) Channels / Voltage-gated Potassium (KV) Channel Blockers / Kaliotoxin

Kaliotoxin

Cat. No. 3564 Submit a Review Datasheet / COA / SDS

Discontinued Product

Kaliotoxin (Cat. No. 3564) has been withdrawn from sale for commercial reasons.
Description: KV and KCa blocker
Datasheet
Citations
Reviews
Literature (5)
Biological Activity Technical Data Datasheets References

Biological Activity for Kaliotoxin

Potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1 and 25 nM for KV1.3, KV1.1 and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels.

Technical Data for Kaliotoxin

M. Wt 4149.94
Formula C171H283N55O49S8
Sequence GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK

(Modifications: Disulfide bridge between 8 - 28, 14 - 33, 18 - 35)
Storage Store at -20°C
CAS Number 145199-73-1
PubChem ID 42601487
InChI Key SKSKHLKOZPRFOV-GFCGCHFTSA-N
Smiles [H]NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC3=CC=CC=C3)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCSC)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CNC=N4)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]4CCCN4C(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CO)NC1=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N3)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC2=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

References for Kaliotoxin

References are publications that support the biological activity of the product.

Romi et al (1993) Synthesis and characterization of kaliotoxin: is the 26-32 sequence essential for potassium channel recognition? J.Biol.Chem. 268 26302 PMID: 8253752

Mourre et al (1999) Distribution in rat brain of binding sites of kaliotoxin, a blocker of Kv1.1and Kv1.3 α-subunits. J.Pharmacol.Exp.Ther. 291 943 PMID: 10565809

Korukottu et al (2008) High-resolution 3D structure determination of kaliotoxin by solid-state NMR spectroscopy. PLoS ONE 3 e2359 PMID: 18523586

View Related Products by Target

View Related Products by Product Action

View all Voltage-gated Potassium (KV) Channel Blockers

Keywords: Kaliotoxin, Kaliotoxin supplier, potassium, channels, blockers, ca2+-activated, voltage, sensitive, gated, K+, venoms, Voltage-Gated, Potassium, Channels, Ca2+-Activated, 3564, Tocris Bioscience

Citations for Kaliotoxin

Citations are publications that use Tocris products.

Currently there are no citations for Kaliotoxin.

Reviews for Kaliotoxin

There are currently no reviews for this product. Be the first to review Kaliotoxin and earn rewards!

Have you used Kaliotoxin?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.

Cardiovascular Research Product Guide

Cardiovascular Research Product Guide

A collection of over 250 products for cardiovascular research, the guide includes research tools for the study of:

  • Hypertension
  • Thrombosis and Hemostasis
  • Atherosclerosis
  • Myocardial Infarction
  • Ischemia/Reperfusion Injury
  • Arrhythmias
  • Heart Failure
Ion Channel Product Listing

Ion Channel Product Listing

A collection of around 500 products for ion channel research, the listing includes research tools for the study of:

  • Ligand-gated ion channels
  • Voltage-gated ion channels
  • Other Ion Channels
Pain Research Product Guide

Pain Research Product Guide

A collection of over 280 products for pain research, the guide includes research tools for the study of:

  • Nociception
  • Ion Channels
  • G-Protein-Coupled Receptors
  • Intracellular Signaling
Epilepsy Poster

Epilepsy Poster

Epilepsy is a brain disease that affects 60 million people globally. More than 20 anti-seizure drugs are currently available, but these do not address the underlying causes of the condition. This poster summarizes current knowledge about the development of the condition and highlights some approaches that have disease-modifying effects in proof-of-concept studies.

Pain Poster

Pain Poster

Peripheral sensitization is the reduction in the threshold of excitability of sensory neurons that results in an augmented response to a given external stimulus. This poster outlines the excitatory and inhibitory signaling pathways involved in modulation of peripheral sensitization. The role of ion channels, GPCRs, neurotrophins, and cytokines in sensory neurons are also described.