Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit Review3564 has been discontinued.
View all Voltage-gated Potassium (K<sub>V</sub>) Channels products.Potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1 and 25 nM for KV1.3, KV1.1 and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels.
| M. Wt | 4149.94 |
| Formula | C171H283N55O49S8 |
| Sequence |
GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Modifications: Disulfide bridge between 8 - 28, 14 - 33, 18 - 35) |
| Storage | Store at -20°C |
| CAS Number | 145199-73-1 |
| PubChem ID | 42601487 |
| InChI Key | SKSKHLKOZPRFOV-GFCGCHFTSA-N |
| Smiles | [H]NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC3=CC=CC=C3)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCSC)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CNC=N4)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]4CCCN4C(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CO)NC1=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N3)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC2=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
References are publications that support the biological activity of the product.
Romi et al (1993) Synthesis and characterization of kaliotoxin: is the 26-32 sequence essential for potassium channel recognition? J.Biol.Chem. 268 26302 PMID: 8253752
Mourre et al (1999) Distribution in rat brain of binding sites of kaliotoxin, a blocker of Kv1.1and Kv1.3 α-subunits. J.Pharmacol.Exp.Ther. 291 943 PMID: 10565809
Korukottu et al (2008) High-resolution 3D structure determination of kaliotoxin by solid-state NMR spectroscopy. PLoS ONE 3 e2359 PMID: 18523586
Keywords: Kaliotoxin, Kaliotoxin supplier, potassium, channels, blockers, ca2+-activated, voltage, sensitive, gated, K+, venoms, Voltage-Gated, Potassium, Channels, Ca2+-Activated, 3564, Tocris Bioscience
Citations are publications that use Tocris products.
Currently there are no citations for Kaliotoxin.
There are currently no reviews for this product. Be the first to review Kaliotoxin and earn rewards!
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image