Guangxitoxin 1E

Pricing Availability   Qty

Save 15% on Select RUO Reagents. See Details. 

Description: Potent Kv2.1 and Kv2.2 channel blocker
Purity: ≥95% (HPLC)
Datasheet
Citations (1)
Reviews (1)

Biological Activity for Guangxitoxin 1E

Guangxitoxin 1E is a Kv2.1 and Kv2.2 channel blocker (IC50 values are 1-3 nM). Enhances glucose-stimulated insulin secretion from human islets in vitro, but not from islet cells lacking the Kv2.1 channel. Has no significant effect on plasma insulin, glucagon or blood glucose levels in mice, but increases plasma somatostatin levels.

Technical Data for Guangxitoxin 1E

M. Wt 3948.61
Formula C178H248N44O45S7
Sequence EGECGGFWWKCGSGKPACCPKYVCSPKWGLCNFPMP

(Modifications: Disulfide bridges: 4-19, 11-24, 18-31)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 1233152-82-3
PubChem ID 121513878
InChI Key SZVUKNYCMKWHNH-UHFFFAOYSA-N
Smiles [H]N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]4CCCN4C(=O)[C@H](CO)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CC4=CC=CC=C4)NC(=O)CNC(=O)CNC1=O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N3)NC(=O)[C@@H](NC(=O)[C@H](CC1=CC=C(O)C=C1)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C2=O)C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(=O)N1CCC[C@H]1C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for Guangxitoxin 1E

Solubility Soluble to 1 mg/ml in water

Product Datasheets for Guangxitoxin 1E

Certificate of Analysis / Product Datasheet
Select another batch:

References for Guangxitoxin 1E

References are publications that support the biological activity of the product.

Li et al (2013) The role of voltage-gated potassium channels Kv2.1 and Kv2.2 in the regulation of Ins and somatostatin release from pancreatic islets. J.Pharmacol.Exp.Ther. 344 407 PMID: 23161216

Herrington (2007) Gating modifier peptides as probes of pancreatic beta-cell physiology. Toxicon 49 231 PMID: 17101164


If you know of a relevant reference for Guangxitoxin 1E, please let us know.

View Related Products by Product Action

View all Voltage-gated Potassium (KV) Channel Blockers

Keywords: Guangxitoxin 1E, Guangxitoxin 1E supplier, Kv2.1, Kv2.2, inward, rectifier, potassium, current, pancreatic, islets, beta, cells, inhibits, inhibitors, insulin, glucose, somatostatin, GxTx-1E, venoms, Voltage-Gated, Potassium, Channels, 5676, Tocris Bioscience

1 Citation for Guangxitoxin 1E

Citations are publications that use Tocris products. Selected citations for Guangxitoxin 1E include:

Il-Whan et al (2017) Escitalopram, a selective serotonin reuptake inhibitor, inhibits voltage-dependent K+ channels in coronary arterial smooth muscle cells. Korean J Physiol Pharmacol 21 415-421 PMID: 28706455


Do you know of a great paper that uses Guangxitoxin 1E from Tocris? Please let us know.

Reviews for Guangxitoxin 1E

Average Rating: 5 (Based on 1 Review.)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%

Have you used Guangxitoxin 1E?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Filter by:


Use of Guangxitoxin 1E in several BK channel studies.
By Anonymous on 01/31/2019
Assay Type: In Vitro
Species: Human

Our lab has used Guangxitoxin 1E in several BK channel studies over the last few years. Our results have always been reliable and reproducible. We will surely continue using this product.

review image