GIP (1-39)

Pricing Availability   Qty
Description: Highly potent insulinotropic peptide; GIP agonist
Alternative Names: Gastric Inhibitory Polypeptide (1-39)
Purity: ≥95% (HPLC)
Datasheet
Citations
Reviews
Literature (3)

Biological Activity for GIP (1-39)

GIP (1-39) is an endogenous truncated form of the incretin hormone GIP. More potent at stimulating glucose-dependent insulin secretion from rat pancreatic β-cells than GIP (Cat. No 2084).

Technical Data for GIP (1-39)

M. Wt 4633.21
Formula C210H316N56O61S
Sequence YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN
Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 725474-97-5
PubChem ID 71300624
InChI Key TWSALRJGPBVBQU-PKQQPRCHSA-N
Smiles [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for GIP (1-39)

Solubility Soluble to 10 mg/ml in water

Product Datasheets for GIP (1-39)

Certificate of Analysis / Product Datasheet
Select another batch:

References for GIP (1-39)

References are publications that support the biological activity of the product.

Xie et al (2004) GIP1-39, a novel Insotropic peptide form and aspects on its mechanism of action. Regul.Peptides 121 107


If you know of a relevant reference for GIP (1-39), please let us know.

View Related Products by Product Action

View all GIP Receptor Agonists

Keywords: GIP (1-39), GIP (1-39) supplier, potent, insulinotropic, peptide, Gastric, inhibitory, Peptide, Receptors, Glucose-Dependent, Insulinotropic, GIP, Glucagon, Inhibitory, Polypeptide, (1-39), 2257, Tocris Bioscience

Citations for GIP (1-39)

Citations are publications that use Tocris products.

Currently there are no citations for GIP (1-39). Do you know of a great paper that uses GIP (1-39) from Tocris? Please let us know.

Reviews for GIP (1-39)

There are currently no reviews for this product. Be the first to review GIP (1-39) and earn rewards!

Have you used GIP (1-39)?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


GPCR Product Listing

GPCR Product Listing

A collection of over 450 products for G protein-coupled receptors, the listing includes research tools for the study of:

  • Rhodopsin-like Receptors
  • Glutamate Receptors
  • Frizzled Receptors
  • GPCR Signaling
Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

A collection of over 200 products for peptide hormone receptors, the listing includes research tools for the study of:

  • Anterior Pituitary Regulation
  • Blood Pressure Regulation
  • Feeding and Appetite Regulation
  • Glucose Regulation
  • Peptide Hormone Processing
Peptides Involved in Appetite Modulation Scientific Review

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.