GIP (human)

Pricing Availability   Qty

Save 15% on Select RUO Reagents. See Details. 

Description: Potent insulinotropic gut hormone; GIP agonist
Alternative Names: Gastric Inhibitory Polypeptide (human)
Purity: ≥95% (HPLC)
Datasheet
Citations
Reviews
Literature (1)

Biological Activity for GIP (human)

GIP (human) is a potent insulinotropic hormone synthesized by duodenal K-cells. High affinity GIP receptor agonist (EC50 = 0.81 nM) that inhibits gastric acid secretion and stimulates pancreatic insulin release in response to glucose. Also affects lipid metabolism and displays mitogenic and antiapoptotic effects in pancreatic β-cells.

Technical Data for GIP (human)

M. Wt 4983.58
Formula C226H338N60O66S
Sequence YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 100040-31-1
PubChem ID 16140499
InChI Key MGXWVYUBJRZYPE-YUGYIWNOSA-N
Smiles [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for GIP (human)

Solubility Soluble to 1 mg/ml in water

Product Datasheets for GIP (human)

Certificate of Analysis / Product Datasheet
Select another batch:

References for GIP (human)

References are publications that support the biological activity of the product.

Wheeler et al (1995) Functional expression of the rat pancreatic islet glucose-dependent Insotropic polypeptide receptor: ligand binding and intracellular signaling properties. Endocrinol. 136 4629

Trumper et al (2001) Glucose-dependent Insotropic polypeptide is a growth factor for β (INS-1) cells by pleiotropic signaling. Mol.Endocrinol. 15 1159

Meier et al (2002) Gastric inhibitory polypeptide: the neglected incretin revisited. Regul.Peptides 107 1


If you know of a relevant reference for GIP (human), please let us know.

View Related Products by Product Action

View all GIP Receptor Agonists

Keywords: GIP (human), GIP (human) supplier, Potent, insulinotropic, gut, hormone, Gastric, inhibitory, Peptide, Receptors, Glucose-Dependent, GIP, Glucagon, Inhibitory, Polypeptide, (human), 2084, Tocris Bioscience

Citations for GIP (human)

Citations are publications that use Tocris products.

Currently there are no citations for GIP (human). Do you know of a great paper that uses GIP (human) from Tocris? Please let us know.

Reviews for GIP (human)

There are currently no reviews for this product. Be the first to review GIP (human) and earn rewards!

Have you used GIP (human)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Peptides Involved in Appetite Modulation Scientific Review

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.