[D-Ala2]-GIP (human)

Pricing Availability   Qty
Description: Highly potent GIP agonist
Purity: ≥95% (HPLC)
Datasheet
Citations
Reviews
Literature (3)

Biological Activity for [D-Ala2]-GIP (human)

[D-Ala2]-GIP (human) is a highly potent GIP receptor agonist (EC50 = 630 ± 119 pM). Displays equivalent cAMP stimulating properties and improved resistance to enzymatic degradation compared to native GIP (Cat. No. 2084) in cells expressing wild type GIP receptor. Improves glucose tolerance, insulin release and cognitive function in various animal models of obesity and diabetes. Displays neuroprotective effects in an MPTP model of PD.

Technical Data for [D-Ala2]-GIP (human)

M. Wt 4983.58
Formula C226H338N60O66S
Sequence YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

(Modifications: Ala-2 = D-Ala)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 444073-04-5
Smiles [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for [D-Ala2]-GIP (human)

Solubility Soluble to 1 mg/ml in water

Product Datasheets for [D-Ala2]-GIP (human)

Certificate of Analysis / Product Datasheet
Select another batch:

References for [D-Ala2]-GIP (human)

References are publications that support the biological activity of the product.

Hinke et al (2002) Dipeptidyl peptidase IV-resistant [D-Ala2]glucose-dependent Insotropic polypeptide (GIP) improves glucose tolerance in normal and obese diabetic rats. Diabetes. 51 652 PMID: 11872663

Porter et al (2011) Prolonged GIP receptor activation improves cognitive function, hippocampal synaptic plasticity and glucose homeostasis in high-fat fed mice. Eur.J.Pharmacol. 650 688 PMID: 21050845

Verma et al (2017) Effect of D-Ala2GIP, a stable GIP receptor agonist on MPTP-induced neuronal impairments in mice. Eur.J.Pharmacol. 804 38 PMID: 28366809


If you know of a relevant reference for [D-Ala2]-GIP (human), please let us know.

View Related Products by Product Action

View all GIP Receptor Agonists

Keywords: [D-Ala2]-GIP (human), [D-Ala2]-GIP (human) supplier, gastric, inhibitory, polypeptide, receptor, enzymatic, resistance, resistant, degradation, GIPR, glucose, dependent, insulinotropic, peptide, agonists, agonism, highly, potent, GIP, Receptors, 6699, Tocris Bioscience

Citations for [D-Ala2]-GIP (human)

Citations are publications that use Tocris products.

Currently there are no citations for [D-Ala2]-GIP (human). Do you know of a great paper that uses [D-Ala2]-GIP (human) from Tocris? Please let us know.

Reviews for [D-Ala2]-GIP (human)

There are currently no reviews for this product. Be the first to review [D-Ala2]-GIP (human) and earn rewards!

Have you used [D-Ala2]-GIP (human)?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


GPCR Product Listing

GPCR Product Listing

A collection of over 450 products for G protein-coupled receptors, the listing includes research tools for the study of:

  • Rhodopsin-like Receptors
  • Glutamate Receptors
  • Frizzled Receptors
  • GPCR Signaling
Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

A collection of over 200 products for peptide hormone receptors, the listing includes research tools for the study of:

  • Anterior Pituitary Regulation
  • Blood Pressure Regulation
  • Feeding and Appetite Regulation
  • Glucose Regulation
  • Peptide Hormone Processing
Peptides Involved in Appetite Modulation Scientific Review

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.