Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewBeKm 1 is a potent and selective KV11.1 (hERG) channel blocker. Selective for KV11.1 over a panel of 14 other potassium channels. Dose-dependently prolongs QTc interval in isolated rabbit heart.
M. Wt | 4091.65 |
Formula | C174H261N51O52S6 |
Sequence |
RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF (Modifications: Disulfide bridge: 7-28,13-33,17-35) |
Storage | Store at -20°C |
CAS Number | 524962-01-4 |
PubChem ID | 121513903 |
InChI Key | OQEMUGXECXBKDP-UHFFFAOYSA-N |
Smiles | [H]N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC3=CC=CC=C3)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC4=CC=C(O)C=C4)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CO)NC1=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N3)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC2=O)C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O)[C@@H](C)O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
References are publications that support the biological activity of the product.
Korolkova et al (2001) An ERG channel inhibitor from the scorpion Buthus eupeus. J.Biol.Chem. 276 9868 PMID: 11136720
Qu et al (2011) BeKm-1, a peptide inhibitor of human ether-a-go-go-related gene potassium currents, prolongs QTc intervals in isolated rabbit heart. J.Pharmacol.Exp.Ther. 337 2 PMID: 21205913
Korolkova et al (2002) New binding site on common molecular scaffold provides HERG channel specificity of scorpion toxin BeKm-1. J.Biol.Chem. 277 43104 PMID: 12151390
Keywords: BeKm 1, BeKm 1 supplier, BeKm1, human, ether-a-go-go, hERG, voltage-gated, potassium, channel, blockers, blocks, K+, Kv11.1, venoms, Voltage-Gated, Potassium, Channels, 5929, Tocris Bioscience
Citations are publications that use Tocris products.
Currently there are no citations for BeKm 1.
There are currently no reviews for this product. Be the first to review BeKm 1 and earn rewards!
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Epilepsy is a brain disease that affects 60 million people globally. More than 20 anti-seizure drugs are currently available, but these do not address the underlying causes of the condition. This poster summarizes current knowledge about the development of the condition and highlights some approaches that have disease-modifying effects in proof-of-concept studies.
Peripheral sensitization is the reduction in the threshold of excitability of sensory neurons that results in an augmented response to a given external stimulus. This poster outlines the excitatory and inhibitory signaling pathways involved in modulation of peripheral sensitization. The role of ion channels, GPCRs, neurotrophins, and cytokines in sensory neurons are also described.