Home / Pharmacology / Ion Channels / Potassium Channels / Voltage-gated Potassium (KV) Channels / Voltage-gated Potassium (KV) Channel Blockers / BeKm 1

BeKm 1

Cat. No. 5929 Submit a Review Datasheet / COA / SDS

Discontinued Product

5929 has been discontinued.

View all Voltage-gated Potassium (K<sub>V</sub>) Channels products.
Description: Potent and selective KV11.1 (hERG) channel blocker
Datasheet
Citations
Reviews
Biological Activity Technical Data Datasheets References

Biological Activity for BeKm 1

BeKm 1 is a potent and selective KV11.1 (hERG) channel blocker. Selective for KV11.1 over a panel of 14 other potassium channels. Dose-dependently prolongs QTc interval in isolated rabbit heart.

Technical Data for BeKm 1

M. Wt 4091.65
Formula C174H261N51O52S6
Sequence RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF

(Modifications: Disulfide bridge: 7-28,13-33,17-35)
Storage Store at -20°C
CAS Number 524962-01-4
PubChem ID 121513903
InChI Key OQEMUGXECXBKDP-UHFFFAOYSA-N
Smiles [H]N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC3=CC=CC=C3)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC4=CC=C(O)C=C4)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CO)NC1=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N3)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC2=O)C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O)[C@@H](C)O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

References for BeKm 1

References are publications that support the biological activity of the product.

Korolkova et al (2001) An ERG channel inhibitor from the scorpion Buthus eupeus. J.Biol.Chem. 276 9868 PMID: 11136720

Qu et al (2011) BeKm-1, a peptide inhibitor of human ether-a-go-go-related gene potassium currents, prolongs QTc intervals in isolated rabbit heart. J.Pharmacol.Exp.Ther. 337 2 PMID: 21205913

Korolkova et al (2002) New binding site on common molecular scaffold provides HERG channel specificity of scorpion toxin BeKm-1. J.Biol.Chem. 277 43104 PMID: 12151390

View Related Products by Target

View Related Products by Product Action

View all Voltage-gated Potassium (KV) Channel Blockers

Keywords: BeKm 1, BeKm 1 supplier, BeKm1, human, ether-a-go-go, hERG, voltage-gated, potassium, channel, blockers, blocks, K+, Kv11.1, venoms, Voltage-Gated, Potassium, Channels, 5929, Tocris Bioscience

Citations for BeKm 1

Citations are publications that use Tocris products.

Currently there are no citations for BeKm 1.

Reviews for BeKm 1

There are currently no reviews for this product. Be the first to review BeKm 1 and earn rewards!

Have you used BeKm 1?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review