BeKm 1

Discontinued Product

BeKm 1 (Cat. No. 5929) has been withdrawn from sale for commercial reasons.
Description: Potent and selective KV11.1 (hERG) channel blocker
Datasheet
Citations
Reviews
Literature (5)

Biological Activity for BeKm 1

BeKm 1 is a potent and selective KV11.1 (hERG) channel blocker. Selective for KV11.1 over a panel of 14 other potassium channels. Dose-dependently prolongs QTc interval in isolated rabbit heart.

Technical Data for BeKm 1

M. Wt 4091.65
Formula C174H261N51O52S6
Sequence RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF

(Modifications: Disulfide bridge: 7-28,13-33,17-35)

Storage Store at -20°C
CAS Number 524962-01-4
PubChem ID 121513903
InChI Key OQEMUGXECXBKDP-UHFFFAOYSA-N
Smiles [H]N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC3=CC=CC=C3)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC4=CC=C(O)C=C4)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CO)NC1=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N3)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC2=O)C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O)[C@@H](C)O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

References for BeKm 1

References are publications that support the biological activity of the product.

Korolkova et al (2001) An ERG channel inhibitor from the scorpion Buthus eupeus. J.Biol.Chem. 276 9868 PMID: 11136720

Qu et al (2011) BeKm-1, a peptide inhibitor of human ether-a-go-go-related gene potassium currents, prolongs QTc intervals in isolated rabbit heart. J.Pharmacol.Exp.Ther. 337 2 PMID: 21205913

Korolkova et al (2002) New binding site on common molecular scaffold provides HERG channel specificity of scorpion toxin BeKm-1. J.Biol.Chem. 277 43104 PMID: 12151390

View Related Products by Product Action

View all Voltage-gated Potassium (KV) Channel Blockers

Keywords: BeKm 1, BeKm 1 supplier, BeKm1, human, ether-a-go-go, hERG, voltage-gated, potassium, channel, blockers, blocks, K+, Kv11.1, venoms, Voltage-Gated, Potassium, Channels, 5929, Tocris Bioscience

Citations for BeKm 1

Citations are publications that use Tocris products.

Currently there are no citations for BeKm 1.

Reviews for BeKm 1

There are currently no reviews for this product. Be the first to review BeKm 1 and earn rewards!

Have you used BeKm 1?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Cardiovascular Research Product Guide

Cardiovascular Research Product Guide

A collection of over 250 products for cardiovascular research, the guide includes research tools for the study of:

  • Hypertension
  • Thrombosis and Hemostasis
  • Atherosclerosis
  • Myocardial Infarction
  • Ischemia/Reperfusion Injury
  • Arrhythmias
  • Heart Failure
Ion Channel Product Listing

Ion Channel Product Listing

A collection of around 500 products for ion channel research, the listing includes research tools for the study of:

  • Ligand-gated ion channels
  • Voltage-gated ion channels
  • Other Ion Channels
Pain Research Product Guide

Pain Research Product Guide

A collection of over 280 products for pain research, the guide includes research tools for the study of:

  • Nociception
  • Ion Channels
  • G-Protein-Coupled Receptors
  • Intracellular Signaling
Epilepsy Poster

Epilepsy Poster

Epilepsy is a brain disease that affects 60 million people globally. More than 20 anti-seizure drugs are currently available, but these do not address the underlying causes of the condition. This poster summarizes current knowledge about the development of the condition and highlights some approaches that have disease-modifying effects in proof-of-concept studies.

Pain Poster

Pain Poster

Peripheral sensitization is the reduction in the threshold of excitability of sensory neurons that results in an augmented response to a given external stimulus. This poster outlines the excitatory and inhibitory signaling pathways involved in modulation of peripheral sensitization. The role of ion channels, GPCRs, neurotrophins, and cytokines in sensory neurons are also described.