Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit Review5929 has been discontinued.
View all Voltage-gated Potassium (K<sub>V</sub>) Channels products.BeKm 1 is a potent and selective KV11.1 (hERG) channel blocker. Selective for KV11.1 over a panel of 14 other potassium channels. Dose-dependently prolongs QTc interval in isolated rabbit heart.
| M. Wt | 4091.65 |
| Formula | C174H261N51O52S6 |
| Sequence |
RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF (Modifications: Disulfide bridge: 7-28,13-33,17-35) |
| Storage | Store at -20°C |
| CAS Number | 524962-01-4 |
| PubChem ID | 121513903 |
| InChI Key | OQEMUGXECXBKDP-UHFFFAOYSA-N |
| Smiles | [H]N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC3=CC=CC=C3)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC4=CC=C(O)C=C4)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CO)NC1=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N3)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC2=O)C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O)[C@@H](C)O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
References are publications that support the biological activity of the product.
Korolkova et al (2001) An ERG channel inhibitor from the scorpion Buthus eupeus. J.Biol.Chem. 276 9868 PMID: 11136720
Qu et al (2011) BeKm-1, a peptide inhibitor of human ether-a-go-go-related gene potassium currents, prolongs QTc intervals in isolated rabbit heart. J.Pharmacol.Exp.Ther. 337 2 PMID: 21205913
Korolkova et al (2002) New binding site on common molecular scaffold provides HERG channel specificity of scorpion toxin BeKm-1. J.Biol.Chem. 277 43104 PMID: 12151390
Keywords: BeKm 1, BeKm 1 supplier, BeKm1, human, ether-a-go-go, hERG, voltage-gated, potassium, channel, blockers, blocks, K+, Kv11.1, venoms, Voltage-Gated, Potassium, Channels, 5929, Tocris Bioscience
Citations are publications that use Tocris products.
Currently there are no citations for BeKm 1.
There are currently no reviews for this product. Be the first to review BeKm 1 and earn rewards!
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image