Amyloid β-peptide (42-1) (human)
Biological Activity
Inactive control peptide for amyloid β-peptide (1-42) (Cat. No. 1428), the predominant form of amyloid β-peptide found in the brains of patients with Alzheimer's disease.
Technical Data
| M. Wt | 4514.08 |
| Formula | C203H311N55O60S |
| Sequence | AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD |
| Storage | Store at -20°C |
| CAS Number | 317366-82-8 |
| PubChem ID | 16132430 |
| InChI Key | PLOPBXQQPZYQFA-AXPWDRQUSA-N |
| Smiles | [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.
Solubility Data
| Solubility | Soluble to 0.50 mg/ml in water |
Preparing Stock Solutions
The following data is based on the product molecular weight 4514.08. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.
| Concentration / Solvent Volume / Mass | 1 mg | 5 mg | 10 mg |
|---|---|---|---|
| 1 mM | 0.22 mL | 1.11 mL | 2.22 mL |
| 5 mM | 0.04 mL | 0.22 mL | 0.44 mL |
| 10 mM | 0.02 mL | 0.11 mL | 0.22 mL |
| 50 mM | 0 mL | 0.02 mL | 0.04 mL |
Molarity Calculator
Reconstitution Calculator
The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.
Dilution Calculator
Product Datasheets
References
References are publications that support the products' biological activity.
Walsh et al (2002) Amyloid-beta peotide is toxic to neurons in vivo via indirect mechanisms. Neurobiol.Dis. 10 20 PMID: 12079400
Xiong et al (2007) Mitochondrial respiratory inhibition and oxidative stress elevate β-secretase (BACE1) proteins and activity in vivo in the rat retina. Exp.Brain Res. 181 435 PMID: 17429617
Boyd-Kimball et al (2005) Proteomic identification of proteins oxidized by Aβ(1-42) in synaptosomes: Implications for Alzheimer's disease. Brain Res. 1004 206 PMID: 15885219
If you know of a relevant reference for Amyloid β-peptide (42-1) (human), please let us know.
View Related Products by Target
Keywords: Inactive control peptide β-Amyloid beta-Amyloid b-amyoid Precursor Protein APP Secretase beta Peptides Amyloid β-peptide beta-peptide (42-1) (human) amyloidbeta amyloidb amyloidβ Amyloid Beta Peptides
1 Citation for Amyloid β-peptide (42-1) (human)
Citations are publications that use Tocris products. Selected citations for Amyloid β-peptide (42-1) (human) include:
Esposito et al (2011) Cannabidiol reduces Aβ-induced neuroinflammation and promotes hippocampal neurogenesis through PPARγ involvement. PLoS One 6 e28668 PMID: 22163051
Do you know of a great paper that uses Amyloid β-peptide (42-1) (human) from Tocris? If so please let us know.
Literature in this Area
Neurodegeneration Product Guide
A collection of over 275 products for neurodegeneration research, the guide includes research tools for the study of:
- Alzheimer's disease
- Parkinson's disease
- Huntington's disease
Alzheimer's Poster
Alzheimer's disease (AD) is a degenerative brain disease and the most common cause of dementia, affecting approximately 47 million people worldwide. Updated in 2015, this poster summarizes the structural and functional changes observed in the progression of this neurodegenerative disease, as well as classic AD drug targets.
