Amyloid β-peptide (42-1) (human)

Cat. No. 3391 1 Citation Submit a Review Datasheet / COA / SDS

Pricing	Availability	Delivery Time	Qty

Bulk Orders

Cat.No. 3391 - Amyloid b-peptide (42-1) (human) | Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp | CAS No. 317366-82-8

Description: Inactive control peptide for amyloid β-peptide (1-42) (Cat. No. 1428)

Datasheet

Citations (1)

Reviews

Literature

Biological Activity Technical Data Solubility Calculators Datasheets References

Biological Activity

Inactive control peptide for amyloid β-peptide (1-42), the predominant form of amyloid β-peptide found in the brains of patients with Alzheimer's disease.

Active Analog also available.

Technical Data

M. Wt	4514.08
Formula	C₂₀₃H₃₁₁N₅₅O₆₀S
Sequence	AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Storage	Store at -20°C
CAS Number	317366-82-8
PubChem ID	16132430
InChI Key	PLOPBXQQPZYQFA-AXPWDRQUSA-N
Smiles	[H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

All Tocris products are intended for laboratory research use only.

Solubility Data

Solubility

Soluble to 0.50 mg/ml in water

Preparing Stock Solutions

The following data is based on the product molecular weight 4514.08. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.

Concentration / Solvent Volume / Mass	1 mg	5 mg	10 mg
1 mM	0.22 mL	1.11 mL	2.22 mL
5 mM	0.04 mL	0.22 mL	0.44 mL
10 mM	0.02 mL	0.11 mL	0.22 mL
50 mM	0 mL	0.02 mL	0.04 mL

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt* g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

Reconstitution Calculator

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1

Volume 1

Concentration 2

Volume 2

Product Datasheets

Certificate of Analysis / Product Datasheet

Safety Datasheet

References

References are publications that support the biological activity of the product.

Walsh et al (2002) Amyloid-beta peotide is toxic to neurons in vivo via indirect mechanisms. Neurobiol.Dis. 10 20 PMID: 12079400

Xiong et al (2007) Mitochondrial respiratory inhibition and oxidative stress elevate β-secretase (BACE1) proteins and activity in vivo in the rat retina. Exp.Brain Res. 181 435 PMID: 17429617

Boyd-Kimball et al (2005) Proteomic identification of proteins oxidized by Aβ(1-42) in synaptosomes: Implications for Alzheimer's disease. Brain Res. 1004 206 PMID: 15885219

If you know of a relevant reference for Amyloid β-peptide (42-1) (human), please let us know.

View Related Products by Target

Keywords: Amyloid b-peptide (42-1) (human), Amyloid b-peptide (42-1) (human) supplier, Inactive, control, peptide, β-Amyloid, beta-Amyloid, b-amyoid, Precursor, Protein, APP, Secretase, beta, Peptides, Amyloid, β-peptide, beta-peptide, (42-1), (human), amyloidbeta, amyloidb, amyloidβ, Beta, 3391, Tocris Bioscience

1 Citation for Amyloid β-peptide (42-1) (human)

Citations are publications that use Tocris products. Selected citations for Amyloid β-peptide (42-1) (human) include:

Esposito et al (2011) Cannabidiol reduces Aβ-induced neuroinflammation and promotes hippocampal neurogenesis through PPARγ involvement. PLoS One 6 e28668 PMID: 22163051

Do you know of a great paper that uses Amyloid β-peptide (42-1) (human) from Tocris? Please let us know.

Reviews for Amyloid β-peptide (42-1) (human)

There are currently no reviews for this product. Be the first to review Amyloid β-peptide (42-1) (human) and earn rewards!

Have you used Amyloid β-peptide (42-1) (human)?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* or download your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.

Neurodegeneration Product Guide

A collection of over 275 products for neurodegeneration research, the guide includes research tools for the study of:

Alzheimer's disease
Parkinson's disease
Huntington's disease

Alzheimer's Poster

Alzheimer's disease (AD) is a degenerative brain disease and the most common cause of dementia, affecting approximately 47 million people worldwide. Updated in 2015, this poster summarizes the structural and functional changes observed in the progression of this neurodegenerative disease, as well as classic AD drug targets.