Home / Cell Biology / Cell Metabolism / Amyloid β Peptides / Amyloid β-Peptide (1-43) (human)

Amyloid β-Peptide (1-43) (human)

Cat. No. 1938 Submit a Review Datasheet / COA / SDS
Pricing Availability Delivery Time Qty
Cat.No. 1938 - Amyloid b-peptide (1-43) (human) | Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Thr | CAS No. 134500-80-4
Description: Amyloid β-protein fragment
Datasheet
Citations
Reviews
Literature
Biological Activity Technical Data Solubility Calculators Datasheets References

Biological Activity

Human β-amyloid peptide; minor component of neuritic plaques found in brains of patients with Alzheimer's disease.

Technical Data

M. Wt 4615.19
Formula C207H318N56O62S
Sequence DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT
Storage Desiccate at -20°C
CAS Number 134500-80-4
PubChem ID 90488728
InChI Key YQWMUHTZOOEROI-ASYIRXGMSA-N
Smiles [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

All Tocris products are intended for laboratory research use only.

Solubility Data

Solubility Soluble to 1 mg/ml in acetic acid

Preparing Stock Solutions

The following data is based on the product molecular weight 4615.19. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.

Concentration / Solvent Volume / Mass 1 mg 5 mg 10 mg
1 mM 0.22 mL 1.08 mL 2.17 mL
5 mM 0.04 mL 0.22 mL 0.43 mL
10 mM 0.02 mL 0.11 mL 0.22 mL
50 mM 0 mL 0.02 mL 0.04 mL

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Dilution Calculator

Calculate the dilution required to prepare a stock solution.
x
=
x

Product Datasheets

Certificate of Analysis / Product Datasheet
Safety Datasheet

References

References are publications that support the biological activity of the product.

Hilbich et al (1991) Human and rodent sequence analogs of Alzheimer's amyloid βA4 share similar properties and can be solubilized in buffers of pH 7.4. Eur.J.Biochem. 201 61 PMID: 1915378

Jarrett et al (1993) The carboxy terminus of the β amyloid protein is critical for the seeding of amyloid formation: implications for the pathogenesis of Alzheimer's disease. Biochemistry 32 4693 PMID: 8490014

Mori et al (1992) Mass spectrometry of purified amyloid β protein in Alzheimer's disease. J.Biol.Chem. 267 17082 PMID: 1512246

If you know of a relevant reference for Amyloid β-Peptide (1-43) (human), please let us know.

View Related Products by Target

Keywords: Amyloid b-peptide (1-43) (human), Amyloid b-peptide (1-43) (human) supplier, Amyloid, β-protein, beta-protein, fragment, β-Amyloid, beta-Amyloid, b-amyloid, Precursor, Protein, APP, Secretase, β-peptide, beta-peptide, (1-43), (human), amyloidbeta, amyloidb, Beta, Peptides, 1938, Tocris Bioscience

Citations for Amyloid β-Peptide (1-43) (human)

Citations are publications that use Tocris products.

Currently there are no citations for Amyloid β-Peptide (1-43) (human). Do you know of a great paper that uses Amyloid β-Peptide (1-43) (human) from Tocris? Please let us know.

Reviews for Amyloid β-Peptide (1-43) (human)

There are currently no reviews for this product. Be the first to review Amyloid β-Peptide (1-43) (human) and earn rewards!

Have you used Amyloid β-Peptide (1-43) (human)?

Submit a review and receive an Amazon gift card.

$10US/$10CAN/€7/£6 gift card for a review without an image

$25US/$25CAN/€18/£15 gift card for a review with an image

*Offer only valid in the USA / Canada, UK and Europe

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* or download your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.

Neurodegeneration

Neurodegeneration Product Guide

A collection of over 275 products for neurodegeneration research, the guide includes research tools for the study of:

  • Alzheimer's disease
  • Parkinson's disease
  • Huntington's disease
Alzheimer's

Alzheimer's Poster

Alzheimer's disease (AD) is a degenerative brain disease and the most common cause of dementia, affecting approximately 47 million people worldwide. Updated in 2015, this poster summarizes the structural and functional changes observed in the progression of this neurodegenerative disease, as well as classic AD drug targets.