Amyloid β-Peptide (1-43) (human)
Biological Activity
Human β-amyloid peptide; minor component of neuritic plaques found in brains of patients with Alzheimer's disease.
Technical Data
| M. Wt | 4615.19 |
| Formula | C207H318N56O62S |
| Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT |
| Storage | Desiccate at -20°C |
| CAS Number | 134500-80-4 |
| PubChem ID | 90488728 |
| InChI Key | YQWMUHTZOOEROI-ASYIRXGMSA-N |
| Smiles | [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.
Solubility Data
| Solubility | Soluble to 1 mg/ml in acetic acid |
Preparing Stock Solutions
The following data is based on the product molecular weight 4615.19. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.
| Concentration / Solvent Volume / Mass | 1 mg | 5 mg | 10 mg |
|---|---|---|---|
| 1 mM | 0.22 mL | 1.08 mL | 2.17 mL |
| 5 mM | 0.04 mL | 0.22 mL | 0.43 mL |
| 10 mM | 0.02 mL | 0.11 mL | 0.22 mL |
| 50 mM | 0 mL | 0.02 mL | 0.04 mL |
Molarity Calculator
Reconstitution Calculator
The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.
Dilution Calculator
Product Datasheets
References
References are publications that support the products' biological activity.
Hilbich et al (1991) Human and rodent sequence analogs of Alzheimer's amyloid βA4 share similar properties and can be solubilized in buffers of pH 7.4. Eur.J.Biochem. 201 61 PMID: 1915378
Jarrett et al (1993) The carboxy terminus of the β amyloid protein is critical for the seeding of amyloid formation: implications for the pathogenesis of Alzheimer's disease. Biochemistry 32 4693 PMID: 8490014
Mori et al (1992) Mass spectrometry of purified amyloid β protein in Alzheimer's disease. J.Biol.Chem. 267 17082 PMID: 1512246
If you know of a relevant reference for Amyloid β-Peptide (1-43) (human), please let us know.
View Related Products by Target
Keywords: Amyloid b-peptide (1-43) (human), supplier, Amyloid, β-protein, beta-protein, fragment, β-Amyloid, beta-Amyloid, b-amyloid, Precursor, Protein, APP, Secretase, β-peptide, beta-peptide, (1-43), (human), amyloidbeta, amyloidb, Amyloid, Beta, Peptides, Tocris Bioscience
Citations for Amyloid β-Peptide (1-43) (human)
Citations are publications that use Tocris products.
Currently there are no citations for Amyloid β-Peptide (1-43) (human). Do you know of a great paper that uses Amyloid β-Peptide (1-43) (human) from Tocris? If so please let us know.
Literature in this Area
Neurodegeneration Product Guide
A collection of over 275 products for neurodegeneration research, the guide includes research tools for the study of:
- Alzheimer's disease
- Parkinson's disease
- Huntington's disease
Alzheimer's Poster
Alzheimer's disease (AD) is a degenerative brain disease and the most common cause of dementia, affecting approximately 47 million people worldwide. Updated in 2015, this poster summarizes the structural and functional changes observed in the progression of this neurodegenerative disease, as well as classic AD drug targets.
