Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewAmyloid β-Peptide (1-40) (human) is a peptide found in plaques in the brains of patients with Alzheimer's disease. Shown to have both neurotrophic and neurotoxic effects.
M. Wt | 4329.86 |
Formula | C194H295N53O58S |
Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
Storage | Store at -20°C |
Purity | ≥95% (HPLC) |
CAS Number | 131438-79-4 |
PubChem ID | 16135555 |
InChI Key | FEWOUVRMGWFWIH-ILZZQXMPSA-N |
Smiles | [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility | Soluble to 1 mg/ml in water |
References are publications that support the biological activity of the product.
Cleary et al (1995) Beta-amyloid(1-40) effects on behavior and memory. Brain Res. 682 69 PMID: 7552329
Kowalska and Badellino (1994) β-Amyloid protein induces platelet aggregation and supports platelet adhesion. Biochem.Biophys.Res.Commun. 205 1829 PMID: 7811271
Miguel-Hidalgo and Cacabelos (1998) Beta-amyloid(1-40)-induced neurodegeneration in the rat hippocampal neurons of the CA1 subfield. Acta Neuropathol. 95 455 PMID: 9600591
Yankner et al (1990) Neurotrophic and neurotoxic effects of amyloid β protein: reversal by tachykinin neuropeptides. Science 250 279 PMID: 2218531
If you know of a relevant reference for Amyloid β-Peptide (1-40) (human), please let us know.
Keywords: Amyloid beta-Peptide (1-40) (human), Amyloid beta-Peptide (1-40) (human) supplier, Amyloid, β-protein, beta-protein, fragment, Precursor, Protein, APP, Secretase, β-peptide, beta-peptides, b-peptides, b-amyloid, β-Amyloid, beta-Amyloid, amyloid, beta-peptide, (1-40), (human), amyloidbeta, amyloidb, amyloidβ, Beta, Peptides, 1191, Tocris Bioscience
Citations are publications that use Tocris products. Selected citations for Amyloid β-Peptide (1-40) (human) include:
Briyal et al (2015) Stimulation of endothelin B receptors by IRL-1620 decreases the progression of Alzheimer's disease. Neuroscience 301 1 PMID: 26022359
Do you know of a great paper that uses Amyloid β-Peptide (1-40) (human) from Tocris? Please let us know.
There are currently no reviews for this product. Be the first to review Amyloid β-Peptide (1-40) (human) and earn rewards!
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image