Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewAmmTX3
Discontinued Product
AmmTX3 (Cat. No. 5659) has been withdrawn from sale for commercial reasons.
Description: KV4 channel blocker
Biological Activity for AmmTX3
AmmTX3 is a KV4 channel blocker. Blocks A-type K+ current (ISA) in mouse cerebellar granule neurons. The accessory dipeptidyl peptidase-like proteins (DPP) 6 and 10 are required for blockade.
Technical Data for AmmTX3
| M. Wt | 3822.47 |
| Formula | C158H262N50O48S6 |
| Sequence |
XIETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP (Modifications: X = Glp, Disulfide bridge: 8-28,13-33,17-35) |
| Storage | Store at -20°C |
| PubChem ID | 121513877 |
| InChI Key | SVJLXERVUUOWID-UHFFFAOYSA-N |
| Smiles | CC[C@H](C)[C@H](NC(=O)[C@@H]1CCC(=O)N1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CO)NC(=O)CNC(=O)CNC(=O)[C@H](CCC(N)=O)NC1=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N3)NC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC2=O)[C@@H](C)CC)C(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(O)=O)C(C)C)[C@@H](C)CC)C(C)C |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Product Datasheets for AmmTX3
References for AmmTX3
References are publications that support the biological activity of the product.
Maffie et al (2013) Dipeptidyl-peptidase-like-proteins confer high sensitivity to the scorpion toxin AmmTX3 to Kv4-mediated A-type K+ channels. J.Physiol. 591 2419 PMID: 23440961
View Related Products by Target
View Related Products by Product Action
Keywords: AmmTX3, AmmTX3 supplier, potassium, K+, channels, blockers, voltage-gated, Kv4, A-type, currents, DPP6, DPP10, venoms, Voltage-Gated, Potassium, Channels, 5659, Tocris Bioscience
Citations for AmmTX3
Citations are publications that use Tocris products.
Currently there are no citations for AmmTX3.
Reviews for AmmTX3
Average Rating: 5 (Based on 1 Review.)
Have you used AmmTX3?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Filter by:
AmmTX3 was used on Kv7.1 channels.
By
Anonymous on 01/23/2019
Assay Type: In Vitro
Species: Human
AmmTX3 was used on Kv7.1 channels to assess its blocking action with increasing temperature.
