AmmTX3

Discontinued Product

5659 has been discontinued.

View all Voltage-gated Potassium (K<sub>V</sub>) Channels products.
Description: KV4 channel blocker
Datasheet
Citations
Reviews (1)

Biological Activity for AmmTX3

AmmTX3 is a KV4 channel blocker. Blocks A-type K+ current (ISA) in mouse cerebellar granule neurons. The accessory dipeptidyl peptidase-like proteins (DPP) 6 and 10 are required for blockade.

Technical Data for AmmTX3

M. Wt 3822.47
Formula C158H262N50O48S6
Sequence XIETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP

(Modifications: X = Glp, Disulfide bridge: 8-28,13-33,17-35)

Storage Store at -20°C
PubChem ID 121513877
InChI Key SVJLXERVUUOWID-UHFFFAOYSA-N
Smiles CC[C@H](C)[C@H](NC(=O)[C@@H]1CCC(=O)N1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CO)NC(=O)CNC(=O)CNC(=O)[C@H](CCC(N)=O)NC1=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N3)NC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC2=O)[C@@H](C)CC)C(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(O)=O)C(C)C)[C@@H](C)CC)C(C)C

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets for AmmTX3

Certificate of Analysis / Product Datasheet
Select another batch:

References for AmmTX3

References are publications that support the biological activity of the product.

Maffie et al (2013) Dipeptidyl-peptidase-like-proteins confer high sensitivity to the scorpion toxin AmmTX3 to Kv4-mediated A-type K+ channels. J.Physiol. 591 2419 PMID: 23440961

View Related Products by Product Action

View all Voltage-gated Potassium (KV) Channel Blockers

Keywords: AmmTX3, AmmTX3 supplier, potassium, K+, channels, blockers, voltage-gated, Kv4, A-type, currents, DPP6, DPP10, venoms, Voltage-Gated, Potassium, Channels, 5659, Tocris Bioscience

Citations for AmmTX3

Citations are publications that use Tocris products.

Currently there are no citations for AmmTX3.

Reviews for AmmTX3

Average Rating: 5 (Based on 1 Review.)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%

Have you used AmmTX3?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Filter by:


AmmTX3 was used on Kv7.1 channels.
By Anonymous on 01/23/2019
Assay Type: In Vitro
Species: Human

AmmTX3 was used on Kv7.1 channels to assess its blocking action with increasing temperature.

review image