Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewAmmTX3 is a KV4 channel blocker. Blocks A-type K+ current (ISA) in mouse cerebellar granule neurons. The accessory dipeptidyl peptidase-like proteins (DPP) 6 and 10 are required for blockade.
M. Wt | 3822.47 |
Formula | C158H262N50O48S6 |
Sequence |
XIETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP (Modifications: X = Glp, Disulfide bridge: 8-28,13-33,17-35) |
Storage | Store at -20°C |
PubChem ID | 121513877 |
InChI Key | SVJLXERVUUOWID-UHFFFAOYSA-N |
Smiles | CC[C@H](C)[C@H](NC(=O)[C@@H]1CCC(=O)N1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CO)NC(=O)CNC(=O)CNC(=O)[C@H](CCC(N)=O)NC1=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N3)NC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC2=O)[C@@H](C)CC)C(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(O)=O)C(C)C)[C@@H](C)CC)C(C)C |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
References are publications that support the biological activity of the product.
Maffie et al (2013) Dipeptidyl-peptidase-like-proteins confer high sensitivity to the scorpion toxin AmmTX3 to Kv4-mediated A-type K+ channels. J.Physiol. 591 2419 PMID: 23440961
Keywords: AmmTX3, AmmTX3 supplier, potassium, K+, channels, blockers, voltage-gated, Kv4, A-type, currents, DPP6, DPP10, venoms, Voltage-Gated, Potassium, Channels, 5659, Tocris Bioscience
Citations are publications that use Tocris products.
Currently there are no citations for AmmTX3.
Average Rating: 5 (Based on 1 Review.)
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Filter by: