AmmTX3

Discontinued Product

AmmTX3 (Cat. No. 5659) has been withdrawn from sale for commercial reasons.
Description: KV4 channel blocker
Datasheet
Citations
Reviews (1)
Literature (5)

Biological Activity for AmmTX3

AmmTX3 is a KV4 channel blocker. Blocks A-type K+ current (ISA) in mouse cerebellar granule neurons. The accessory dipeptidyl peptidase-like proteins (DPP) 6 and 10 are required for blockade.

Technical Data for AmmTX3

M. Wt 3822.47
Formula C158H262N50O48S6
Sequence XIETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP

(Modifications: X = Glp, Disulfide bridge: 8-28,13-33,17-35)

Storage Store at -20°C
PubChem ID 121513877
InChI Key SVJLXERVUUOWID-UHFFFAOYSA-N
Smiles CC[C@H](C)[C@H](NC(=O)[C@@H]1CCC(=O)N1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CO)NC(=O)CNC(=O)CNC(=O)[C@H](CCC(N)=O)NC1=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N3)NC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC2=O)[C@@H](C)CC)C(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(O)=O)C(C)C)[C@@H](C)CC)C(C)C

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets for AmmTX3

Certificate of Analysis / Product Datasheet
Select another batch:

References for AmmTX3

References are publications that support the biological activity of the product.

Maffie et al (2013) Dipeptidyl-peptidase-like-proteins confer high sensitivity to the scorpion toxin AmmTX3 to Kv4-mediated A-type K+ channels. J.Physiol. 591 2419 PMID: 23440961

View Related Products by Product Action

View all Voltage-gated Potassium (KV) Channel Blockers

Keywords: AmmTX3, AmmTX3 supplier, potassium, K+, channels, blockers, voltage-gated, Kv4, A-type, currents, DPP6, DPP10, venoms, Voltage-Gated, Potassium, Channels, 5659, Tocris Bioscience

Citations for AmmTX3

Citations are publications that use Tocris products.

Currently there are no citations for AmmTX3.

Reviews for AmmTX3

Average Rating: 5 (Based on 1 Review.)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%

Have you used AmmTX3?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Filter by:


AmmTX3 was used on Kv7.1 channels.
By Anonymous on 01/23/2019
Assay Type: In Vitro
Species: Human

AmmTX3 was used on Kv7.1 channels to assess its blocking action with increasing temperature.

review image

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Cardiovascular Research Product Guide

Cardiovascular Research Product Guide

A collection of over 250 products for cardiovascular research, the guide includes research tools for the study of:

  • Hypertension
  • Thrombosis and Hemostasis
  • Atherosclerosis
  • Myocardial Infarction
  • Ischemia/Reperfusion Injury
  • Arrhythmias
  • Heart Failure
Ion Channel Product Listing

Ion Channel Product Listing

A collection of around 500 products for ion channel research, the listing includes research tools for the study of:

  • Ligand-gated ion channels
  • Voltage-gated ion channels
  • Other Ion Channels
Pain Research Product Guide

Pain Research Product Guide

A collection of over 280 products for pain research, the guide includes research tools for the study of:

  • Nociception
  • Ion Channels
  • G-Protein-Coupled Receptors
  • Intracellular Signaling
Epilepsy Poster

Epilepsy Poster

Epilepsy is a brain disease that affects 60 million people globally. More than 20 anti-seizure drugs are currently available, but these do not address the underlying causes of the condition. This poster summarizes current knowledge about the development of the condition and highlights some approaches that have disease-modifying effects in proof-of-concept studies.

Pain Poster

Pain Poster

Peripheral sensitization is the reduction in the threshold of excitability of sensory neurons that results in an augmented response to a given external stimulus. This poster outlines the excitatory and inhibitory signaling pathways involved in modulation of peripheral sensitization. The role of ion channels, GPCRs, neurotrophins, and cytokines in sensory neurons are also described.