ω-Agatoxin IVA

Pricing Availability   Qty

Save 15% on Select RUO Reagents. See Details. 

Description: CaV2.1 blocker
Alternative Names: ω-Aga-IV A
Purity: ≥95% (HPLC)
Datasheet
Citations (6)
Reviews (1)

Biological Activity for ω-Agatoxin IVA

ω-Agatoxin IVA is a selective blocker of P-type calcium channels (IC50 < 1 - 3 nM). Also inhibits N-type channels at micromolar concentrations.

Technical Data for ω-Agatoxin IVA

M. Wt 5202.25
Formula C217H360N68O60S10
Sequence KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

(Modifications: Disulfide bridges: 4-20, 12-25, 19-36, 27-34)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 145017-83-0
PubChem ID 56841669
InChI Key NVVFOMZVLALQKT-JYRRICCISA-N
Smiles [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]4CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CC5=CC=C(O)C=C5)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@@H](NC1=O)[C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC5=C1C=CC=C5)C(=O)NCC(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N3)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC2=O)[C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N4)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for ω-Agatoxin IVA

Solubility Soluble to 1 mg/ml in water

Product Datasheets for ω-Agatoxin IVA

Certificate of Analysis / Product Datasheet
Select another batch:

References for ω-Agatoxin IVA

References are publications that support the biological activity of the product.

Mintz et al (1992) P-type calcium channels blocked by the spider toxin ω-Aga-IVA. Nature 355 827 PMID: 1311418

Turner et al (1992) Calcium channels coupled to glutamate release identified by ω-Aga-IVA. Science 258 310 PMID: 1357749

Bourinet et al (1999) Splicing of α1A subunit gene generates phenotypic variants of P- and Q-type calcium channels. Nat.Neurosci. 2 407 PMID: 10321243

Tringham et al (2008) Protease treatment of cerebellar purkinje cells renders ω-agatoxin IVA-sensitive Ca2+ channels insensitive to inhibition by ω-conotoxin GVIA. J.Pharmacol.Exp.Ther. 324 806 PMID: 17975010


If you know of a relevant reference for ω-Agatoxin IVA, please let us know.

View Related Products by Product Action

View all CaV2.x Channel Blockers

Keywords: w-Agatoxin IVA, w-Agatoxin IVA supplier, Ca2+, channel, blockers, P-type, Calcium, CaV, Channels, voltage-gated, voltage-dependent, ω-Agatoxin, omega-Agatoxin, IVA, w-AgatoxinIVA, w-Aga-IVA, ω-Aga-IVA, venoms, w-Aga-IV, A, Cav2.x, 2799, Tocris Bioscience

6 Citations for ω-Agatoxin IVA

Citations are publications that use Tocris products. Selected citations for ω-Agatoxin IVA include:

Kim et al (2018) Voltage-dependent Ca2+ channels promote branching morphogenesis of salivary glands by patterning differential growth. Sci Rep 8 7566 PMID: 29765108

Medrihan et al (2013) Synapsin II desynchronizes neurotransmitter release at inhibitory synapses by interacting with presynaptic calcium channels. Nature 4 1512 PMID: 23443540

Bellono (2017) Molecular basis of ancestral vertebrate electroreception. Nature 543 391 PMID: 28264196

Jiang et al (2010) The maturation of GABAergic transmission in visual cortex requires endocannabinoid-mediated LTD of inhibitory inputs during a critical period. Neuron 66 248 PMID: 20435001


Do you know of a great paper that uses ω-Agatoxin IVA from Tocris? Please let us know.

Reviews for ω-Agatoxin IVA

Average Rating: 5 (Based on 1 Review.)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%

Have you used ω-Agatoxin IVA?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Filter by:


The pharmacological inhibitors for electrophysiology assay.
By Anonymous on 02/28/2020
Assay Type: In Vitro
Species: skate

The following concentrations we were used:1 μM Bay K, 10 μM nifedipine, 10 μM nimodipine, 300 nM omega -agatoxin, 1 μM omega -conotoxin, 5 μM mibefradil, 1 μM tetrodotoxin, 1 μM charybdotoxin, 100 nM iberiotoxin, 10 μM NS11021.

PMID: 28264196
review image