ω-Agatoxin IVA

Cat. No. 2799

w-Agatoxin IVA Lys-Lys-Lys-Cys-Ile-Ala-Lys-Asp-Tyr-Gly-Arg-Cys-Lys-Trp-Gly-Gly-Thr-Pro-Cys-Cys-Arg-Gly-Arg-Gly-Cys-Ile-Cys-Ser-Ile-Met-Gly-Thr-Asn-Cys-Glu-Cys-Lys-Pro-Arg-Leu-Ile-Met-Glu-Gly-Leu-Gly-Leu-Ala (Disulfide bridge: C4-C20,C12-C25,C19-C36,C27-34)

Price and Availability

For ω-Agatoxin IVA pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: ω-Aga-IV A

Biological Activity

Selective blocker of P-type calcium channels (IC50 < 1 - 3 nM). Also inhibits N-type channels at micromolar concentrations.

Technical Data

M.Wt:
5202.25
Formula:
C217H360N68O60S10
Sequence:
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

(Modifications: Disulfide bridge between 4 - 20, 12 - 25, 19 - 36, 27 - 34)

Solubility:
Soluble in water
Storage:
Desiccate at -20°C
CAS No:
145017-83-0

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

Tringham et al (2008) Protease treatment of cerebellar purkinje cells renders ω-agatoxin IVA-sensitive Ca2+ channels insensitive to inhibition by ω-conotoxin GVIA. J.Pharmacol.Exp.Ther. 324 806. PMID: 17975010.

Bourinet et al (1999) Splicing of α1A subunit gene generates phenotypic variants of P- and Q-type calcium channels. Nat.Neurosci. 2 407. PMID: 10321243.

Mintz et al (1992) P-type calcium channels blocked by the spider toxin ω-Aga-IVA. Nature 355 827. PMID: 1311418.

Turner et al (1992) Calcium channels coupled to glutamate release identified by ω-Aga-IVA. Science 258 310. PMID: 1357749.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products. Selected citations for ω-Agatoxin IVA include:

Higley and Sabatini (2010) Competitive regulation of synaptic Ca2+ influx by D2 dopamine and A2A adenosine receptors. Nat Neurosci 13 958. PMID: 20601948.

Jiang et al (2010) The maturation of GABAergic transmission in visual cortex requires endocannabinoid-mediated LTD of inhibitory inputs during a critical period. Neuron 66 248. PMID: 20435001.

Do you know of a great paper that uses ω-Agatoxin IVA from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: w-Agatoxin IVA, supplier, Ca2+, channel, blockers, P-type, Calcium, CaV, Channels, voltage-gated, voltage-dependent, ω-Agatoxin, omega-Agatoxin, IVA, w-AgatoxinIVA, w-Aga-IVA, ω-Aga-IVA, Tocris Bioscience, Voltage-gated Calcium Channel (CaV) Blocker products

Quick Order

Find multiple products by catalog number

divider line

Pain Research Product Guide

Pain Research Product Guide

Our Pain guide highlights over 280 products for Pain research. Request copy or view PDF today.

divider line

Cardiovascular Research Product Guide

Cardiovascular Research Product Guide

Our Cardiovascular Guide highlights over 250 products for cardiovascular research. Request copy or view PDF today.

divider line

Antidepressants - Current and Future Targets

Written by P. Skolnich et al

Depression Life Science Poster

Our Depression poster highlights presynaptic and postsynaptic targets for the potential treatment of major depressive disorder. Request copy or view PDF today.

divider line

Twitter Updates

Follow @Tocris on Twitter

Follow us on Twitter!

Tocris is now actively tweeting. For regular updates on news, events and special offers, follow @Tocris on Twitter.