[Pro3]-GIP (Rat)

Discontinued Product

[Pro3]-GIP (Rat) (Cat. No. 5837) has been withdrawn from sale for commercial reasons.
Description: High affinity rat GIP partial agonist
Datasheet
Citations
Reviews
Literature (1)

Biological Activity for [Pro3]-GIP (Rat)

[Pro3]-GIP (Rat) is a high affinity rat GIP receptor partial agonist (Kd = 13 nM). Increases cAMP accumulation in COS-7 cells transfected with rat GIP receptor, while also acting as a competitive antagonist of GIP.

Technical Data for [Pro3]-GIP (Rat)

M. Wt 4970.63
Formula C226H343N61O64S
Sequence YAPGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
Storage Store at -20°C
PubChem ID 121513896
InChI Key MAEZQGLUYPOMQT-DYJGCSTISA-N
Smiles [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets for [Pro3]-GIP (Rat)

Certificate of Analysis / Product Datasheet
Select another batch:

References for [Pro3]-GIP (Rat)

References are publications that support the biological activity of the product.

Sparre-Ulrich et al (2016) Species-specific action of (Pro3)GIP - a full agonist at human GIP receptors, but a partial agonist and competitive antagonist at rat and mouse GIP receptors. Br.J.Pharmacol. 173 27 PMID: 26359804

View Related Products by Product Action

View all GIP Receptor Agonists

Keywords: [Pro3]-GIP (Rat), [Pro3]-GIP (Rat) supplier, GIP, receptors, antagonists, antagonism, glucose-dependent, insulinotropic, polypeptide, partial, agonist, agonism, insulin, Receptors, 5837, Tocris Bioscience

Citations for [Pro3]-GIP (Rat)

Citations are publications that use Tocris products.

Currently there are no citations for [Pro3]-GIP (Rat).

Reviews for [Pro3]-GIP (Rat)

There are currently no reviews for this product. Be the first to review [Pro3]-GIP (Rat) and earn rewards!

Have you used [Pro3]-GIP (Rat)?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Peptides Involved in Appetite Modulation Scientific Review

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.