[Pro3]-GIP (Mouse)

Pricing Availability   Qty
Description: GIP receptor antagonist
Purity: ≥95% (HPLC)
Datasheet
Citations
Reviews
Literature (3)

Biological Activity for [Pro3]-GIP (Mouse)

[Pro3]-GIP (Mouse) is a GIP receptor antagonist (IC50 = 2.6μM). Inhibits GIP-stimulated insulin release from pancreatic β cells in vitro. In ob/ob mice, blocks the effects of GIP on insulin release and plasma glucose levels. Also improves intraperitoneal glucose tolerance, insulin sensitivity, and glucose response to feeding in ob/ob mice.

Technical Data for [Pro3]-GIP (Mouse)

M. Wt 4971.62
Formula C225H342N62O64S
Sequence YAPGTFISDYSIAMDKIRQQDFVNWLLAQRGKKSDWKHNITQ
Storage Store at -20°C
Purity ≥95% (HPLC)
PubChem ID 121513896
InChI Key MAEZQGLUYPOMQT-DYJGCSTISA-N
Smiles [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for [Pro3]-GIP (Mouse)

Solubility Soluble to 2 mg/ml in water

Product Datasheets for [Pro3]-GIP (Mouse)

Certificate of Analysis / Product Datasheet
Select another batch:

References for [Pro3]-GIP (Mouse)

References are publications that support the biological activity of the product.

Irwin et al (2007) Early administration of the glucose-dependent Insotropic polypeptide receptor antagonist (Pro3)GIP prevents the development of diabetes and related metabolic abnormalities associated with genetically inherited obesity in ob/ob mice. Diabetologia 50 1532 PMID: 17486314

Gault et al (2002) Characterization of the cellular and metabolic effects of a novel enzyme-resistant antagonist of glucose-dependent Insotropic polypeptide. Biochem.Biophys.Res.Commun. 290 1420 PMID: 11820780


If you know of a relevant reference for [Pro3]-GIP (Mouse), please let us know.

View Related Products by Product Action

View all GIP Receptor Antagonists

Keywords: [Pro3]-GIP (Mouse), [Pro3]-GIP (Mouse) supplier, GIP, receptors, antagonists, antagonism, glucose-dependent, insulinotropic, polypeptide, diabetes, obesity, glucose, insulin, Receptors, 5838, Tocris Bioscience

Citations for [Pro3]-GIP (Mouse)

Citations are publications that use Tocris products.

Currently there are no citations for [Pro3]-GIP (Mouse). Do you know of a great paper that uses [Pro3]-GIP (Mouse) from Tocris? Please let us know.

Reviews for [Pro3]-GIP (Mouse)

There are currently no reviews for this product. Be the first to review [Pro3]-GIP (Mouse) and earn rewards!

Have you used [Pro3]-GIP (Mouse)?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


GPCR Product Listing

GPCR Product Listing

A collection of over 450 products for G protein-coupled receptors, the listing includes research tools for the study of:

  • Rhodopsin-like Receptors
  • Glutamate Receptors
  • Frizzled Receptors
  • GPCR Signaling
Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

A collection of over 200 products for peptide hormone receptors, the listing includes research tools for the study of:

  • Anterior Pituitary Regulation
  • Blood Pressure Regulation
  • Feeding and Appetite Regulation
  • Glucose Regulation
  • Peptide Hormone Processing
Peptides Involved in Appetite Modulation Scientific Review

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.