Pancreatic Polypeptide (human)

Pricing Availability   Qty
Description: NPY Y4 agonist; involved in gastrointestinal tract function
Purity: ≥95% (HPLC)
Datasheet
Citations
Reviews
Literature (4)

Biological Activity for Pancreatic Polypeptide (human)

Pancreatic Polypeptide (human) is an endogenous high affinity agonist for human NPY Y4 receptor (Ki = 0.056 nM). Believed to play an important role in the function of the gastrointestinal tract.

Technical Data for Pancreatic Polypeptide (human)

M. Wt 4181.7
Formula C185H287N53O54S2
Sequence APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY

(Modification: Tyr-36 = C-terminal amide)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 75976-10-2
PubChem ID 24868176
InChI Key HFDKKNHCYWNNNQ-YOGANYHLSA-N
Smiles [H]N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for Pancreatic Polypeptide (human)

Solubility Soluble to 0.70 mg/ml in water

Product Datasheets for Pancreatic Polypeptide (human)

Certificate of Analysis / Product Datasheet
Select another batch:

References for Pancreatic Polypeptide (human)

References are publications that support the biological activity of the product.

Bard et al (1995) Cloning and functional expression of a human Y4 subtype receptor for pancreatic polypeptide, neuropeptide Y, and peptide YY. J.Biol.Chem. 270 26762 PMID: 7592911

Gehlert (1998) Multiple receptors for the pancreatic polypeptide (PP-fold) family: physiological implications. Proc.Soc.Exp.Biol.Med. 218 7 PMID: 9572148

Michel et al (1998) XVI. International Union of Pharmacology recommendations for the nomenclature of neuropeptide Y, peptide YY, and pancreatic polypeptide receptors. Pharmacol.Rev. 50 143 PMID: 9549761


If you know of a relevant reference for Pancreatic Polypeptide (human), please let us know.

View Related Products by Target

View Related Products by Product Action

View all NPY Receptor Agonists

Keywords: Pancreatic Polypeptide (human), Pancreatic Polypeptide (human) supplier, NPY, Y4, agonist, involved, gastrointestinal, tract, function, Neuropeptide, Y, Receptors, neuropeptides, 1154, Tocris Bioscience

Citations for Pancreatic Polypeptide (human)

Citations are publications that use Tocris products.

Currently there are no citations for Pancreatic Polypeptide (human). Do you know of a great paper that uses Pancreatic Polypeptide (human) from Tocris? Please let us know.

Reviews for Pancreatic Polypeptide (human)

There are currently no reviews for this product. Be the first to review Pancreatic Polypeptide (human) and earn rewards!

Have you used Pancreatic Polypeptide (human)?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


GPCR Product Listing

GPCR Product Listing

A collection of over 450 products for G protein-coupled receptors, the listing includes research tools for the study of:

  • Rhodopsin-like Receptors
  • Glutamate Receptors
  • Frizzled Receptors
  • GPCR Signaling
Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

A collection of over 200 products for peptide hormone receptors, the listing includes research tools for the study of:

  • Anterior Pituitary Regulation
  • Blood Pressure Regulation
  • Feeding and Appetite Regulation
  • Glucose Regulation
  • Peptide Hormone Processing
Peptides Involved in Appetite Modulation Scientific Review

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.

Cardiovascular Poster

Cardiovascular Poster

Cardiovascular disease remains one of the major causes of morbidity and mortality in the Western world and therefore this therapeutic area continues to be of great interest to researchers. This poster highlights the key GPCRs regulating vascular reactivity.