GLP-2 (human)

Pricing Availability   Qty
Description: Endogenous hormone; displays intestinotrophic activity
Alternative Names: Glucagon-like peptide 2 (human)
Purity: ≥95% (HPLC)
Datasheet
Citations (2)
Reviews
Literature (1)

Biological Activity for GLP-2 (human)

GLP-2 (human) is an endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on gastrointestinal function including regulation of intestinal glucose transport, food intake, and gastric acid secretion.

GLP-2 (rat) also available.

Technical Data for GLP-2 (human)

M. Wt 3766.14
Formula C165H254N44O55S
Sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 223460-79-5
PubChem ID 90488756
InChI Key JPRUMPQGPCFDGW-CWHSZFSPSA-N
Smiles [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for GLP-2 (human)

Solubility Soluble to 1 mg/ml in 5% NH4OH / water

Product Datasheets for GLP-2 (human)

Certificate of Analysis / Product Datasheet
Select another batch:

References for GLP-2 (human)

References are publications that support the biological activity of the product.

Rocha et al (2004) Glucagon-like peptide-2: divergent signalling pathways. J.Surg.Res. 121 5 PMID: 15313368

Brubaker and Drucker (2004) Glucagon-like peptides regulate cell proliferation and apoptosis in the pancreas, gut, and central nervous system. Endocrinol. 145 2653

Bulut et al (2004) Glucagon-like peptide 2 improves intestinal wound healing through induction of epithelial cell migration in vitro-evidence for a TGF-β-mediated effect. Reg.Peptides 121 137


If you know of a relevant reference for GLP-2 (human), please let us know.

Keywords: GLP-2 (human), GLP-2 (human) supplier, Endogenous, hormone, displays, intestinotrophic, activity, GLP2, Receptors, Glucagon-Like, Peptide, 2, Glucagon, like, peptide2, (human), Glucagon-like, peptide, 2258, Tocris Bioscience

2 Citations for GLP-2 (human)

Citations are publications that use Tocris products. Selected citations for GLP-2 (human) include:

Li et al (2016) GLP-2 Attenuates LPS-Induced Inflammation in BV-2 Cells by Inhibiting ERK1/2, JNK1/2 and NF-κB Signaling Pathways. Int J Mol Sci 17 PMID: 26861286

Baldassano et al (2009) Glucagon-like peptide-2 modulates neurally evoked mucosal chloride secretion in guinea pig small intestine in vitro. Am J Physiol Gastrointest Liver Physiol 297 G800 PMID: 19628655


Do you know of a great paper that uses GLP-2 (human) from Tocris? Please let us know.

Reviews for GLP-2 (human)

There are currently no reviews for this product. Be the first to review GLP-2 (human) and earn rewards!

Have you used GLP-2 (human)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Peptides Involved in Appetite Modulation Scientific Review

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.