Exendin-4

Pricing Availability   Qty

Save 26% on Select RUO Reagents. See Details

Description: Potent GLP-1 receptor agonist
Alternative Names: Exenatide,AC 2993
Purity: ≥95% (HPLC)
Datasheet
Citations (8)
Reviews
Literature (1)

Biological Activity for Exendin-4

Exendin-4 is a high affinity glucagon-like peptide 1 (GLP-1) receptor agonist (Kd = 136 pM); originally isolated from Heloderma suspectum venom. Exendin-4 potently induces cAMP formation without stimulating amylase release in pancreatic acini. Potentiates glucose-induced insulin secretion in isolated rat islets. Exendin-4 protects against glutamate-induced neurotoxicity, and in a mouse model of metabolic imblance it reduces neuroinflammation and enhances long-term-potentiation.

Technical Data for Exendin-4

M. Wt 4186.61
Formula C184H282N50O60S
Sequence HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

(Modifications: Ser-39 = C-terminal amide)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 141758-74-9
PubChem ID 16157882
InChI Key HTQBXNHDCUEHJF-XWLPCZSASA-N
Smiles [H]N[C@@H](CC1=CNC=N1)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for Exendin-4

Solubility Soluble to 1 mg/ml in water

Product Datasheets for Exendin-4

Certificate of Analysis / Product Datasheet
Select another batch:

View Related Products by Product Action

View all Glucagon-Like Peptide 1 Receptor Agonists

Keywords: Exendin-4, Exendin-4 supplier, Potent, GLP-1, receptor, agonists, Receptors, Glucagon-Like, Peptide, 1, AC2993, Ex4, exenatide, neuroprotective, neuroinflammation, neurotoxicity, LTP, Exenatide, AC, 2993, 1933, Tocris Bioscience

8 Citations for Exendin-4

Citations are publications that use Tocris products. Selected citations for Exendin-4 include:

Wang et al (2013) Glucagon-like peptide-1 protects against cardiac microvascular injury in diabetes via a cAMP/PKA/Rho-dependent mechanism. PLoS One 62 1697 PMID: 23364453

Suissa et al (2013) Gastrin: a distinct fate of neurogenin3 positive progenitor cells in the embryonic pancreas. ACS Chem Biol 8 e70397 PMID: 23940571

Vallof et al (2019) Glucagon-like peptide-1 receptors within the nucleus of the solitary tract regulate alcohol-mediated behaviors in rodents. Neuropharmacology 149 124 PMID: 30772374

Jazayeri (2017) Crystal structure of the GLP-1 receptor bound to a peptide agonist. Nature 546 254 PMID: 28562586


Do you know of a great paper that uses Exendin-4 from Tocris? Please let us know.

Reviews for Exendin-4

There are currently no reviews for this product. Be the first to review Exendin-4 and earn rewards!

Have you used Exendin-4?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Peptides Involved in Appetite Modulation Scientific Review

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.