We're moving to rndsystems.com. Come with us!

After July 31, 2026, Tocris Bioscience products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ACTH (1-39)

Pricing Availability   Qty
Description: Potent endogenous MC2 agonist
Alternative Names: Adrenocorticotropic hormone (1-39)
Purity: ≥95% (HPLC)
Datasheet
Citations (4)
Reviews
Literature (1)

Biological Activity for ACTH (1-39)

ACTH (1-39) is a potent endogenous melanocortin receptor 2 (MC2) agonist (EC50 = 57 pM). Component of the hypothalamic-pituitary-adrenal (HPA) axis that stimulates glucocorticoid production and release from the adrenal cortex. Induces insulin resistance, promotes a proinflammatory profile and stimulates UCP-1 in adipocytes in vitro.

Technical Data for ACTH (1-39)

M. Wt 4541.1
Formula C207H308N56O58S
Sequence SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 12279-41-3
PubChem ID 90488852
InChI Key KNOZNCXWNQVSDB-LAZPIJHFSA-N
Smiles [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for ACTH (1-39)

Solubility Soluble to 1 mg/ml in water

Product Datasheets for ACTH (1-39)

Certificate of Analysis / Product Datasheet
Select another batch:

References for ACTH (1-39)

References are publications that support the biological activity of the product.

Kapas et al (1996) Agonist and receptor binding properties of adrenocorticotropin peptides using the cloned mouse adrenocorticotropin receptor expressed in a stably transfected HeLa cell line. Endocrinology 137 3291 PMID: 8754753

Iwen et al (2008) Melanocortin crosstalk with adipose functions: ACTH directly induces Ins resistance, promotes a pro-inflammatory adipokine profile and stimulates UCP-1 in adipocytes. J.Endocrinol. 196 465 PMID: 18310442

Bertolini et al (2009) Brain effects of melanocortins. Pharmacol.Res. 59 13 PMID: 18996199


If you know of a relevant reference for ACTH (1-39), please let us know.

View Related Products by Product Action

View all Melanocortin (MC) Receptor Agonists

Keywords: ACTH (1-39), ACTH (1-39) supplier, Potent, endogenous, MC2R, agonists, Receptors, Melanocortin, acethropan, Adrenocorticotropic, hormone, (1-39), 3492, Tocris Bioscience

4 Citations for ACTH (1-39)

Citations are publications that use Tocris products. Selected citations for ACTH (1-39) include:

Nepomuceno et al (2018) Re-evaluation of Adrenocorticotropic Hormone and Melanocyte Stimulating Hormone Activation of GPR139 in Vitro. Front Pharmacol 9 157 PMID: 29599718

Nøhr et al (2017) The orphan G protein-coupled receptor GPR139 is activated by the peptides: Adrenocorticotropic hormone (ACTH), α-, and β-melanocyte stimulating hormone (α-MSH, and β-MSH), and the conserved core motif HFRW. Neurochem Int 102 105 PMID: 27916541

Ewa et al (2021) Novel bifunctional hybrid compounds designed to enhance the effects of opioids and antagonize the pronociceptive effects of nonopioid peptides as potent analgesics in a rat model of neuropathic pain. Pain 162 432-445 PMID: 32826750

Martineau et al (2014) The atherogenic Scarb1 null mouse model shows a high bone mass phenotype. Am J Physiol Endocrinol Metab 306 E48 PMID: 24253048


Do you know of a great paper that uses ACTH (1-39) from Tocris? Please let us know.

Reviews for ACTH (1-39)

There are currently no reviews for this product. Be the first to review ACTH (1-39) and earn rewards!

Have you used ACTH (1-39)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Peptides Involved in Appetite Modulation Scientific Review

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.