Exendin-3 (9-39) amide

Pricing Availability   Qty
Description: Potent GLP-1 receptor antagonist
Purity: ≥95% (HPLC)
Datasheet
Citations (5)
Reviews
Literature (1)

Biological Activity for Exendin-3 (9-39) amide

Exendin-3 (9-39) amide is a potent and selective GLP-1 receptor antagonist (Kd = 1.7 nM at cloned human GLP-1 receptors). Inhibits cAMP production and insulin release induced by GLP-1 (7-36), exendin-3 (IC50 = 20 nM) and exendin-4. Blocks the inhibitory effect of GLP-1 on food intake in rats.

Technical Data for Exendin-3 (9-39) amide

M. Wt 3369.79
Formula C149H234N40O47S
Sequence DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

(Modifications: Ser-31 = C-terminal amide)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 133514-43-9
PubChem ID 16198321
InChI Key WSEVKKHALHSUMB-MVNVRWBSSA-N
Smiles [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for Exendin-3 (9-39) amide

Solubility Soluble to 1 mg/ml in water

Product Datasheets for Exendin-3 (9-39) amide

Certificate of Analysis / Product Datasheet
Select another batch:

View Related Products by Product Action

View all Glucagon-Like Peptide 1 Receptor Antagonists

Keywords: Exendin-3 (9-39) amide, Exendin-3 (9-39) amide supplier, Potent, GLP-1, receptor, antagonists, Receptors, Glucagon-Like, Peptide, 1, 2081, Tocris Bioscience

5 Citations for Exendin-3 (9-39) amide

Citations are publications that use Tocris products. Selected citations for Exendin-3 (9-39) amide include:

Vallof et al (2019) Glucagon-like peptide-1 receptors within the nucleus of the solitary tract regulate alcohol-mediated behaviors in rodents. Neuropharmacology

Tuesta (2017) GLP-1 acts on habenular avoidance circuits to control nicotine intake. Nat Neurosci 20 708 PMID: 28368384

Gaitonde et al (2012) The role of the gut hormone GLP-1 in the metabolic improvements caused by ileal transposition. J Surg Res 178 33 PMID: 22929182

Bauer et al (2018) Lactobacillus gasseri in the Upper Small Intestine Impacts an ACSL3-Dependent Fatty Acid-Sensing Pathway Regulating Whole-Body Glucose Homeostasis. Cell Metab 27 572 PMID: 29514066


Do you know of a great paper that uses Exendin-3 (9-39) amide from Tocris? Please let us know.

Reviews for Exendin-3 (9-39) amide

There are currently no reviews for this product. Be the first to review Exendin-3 (9-39) amide and earn rewards!

Have you used Exendin-3 (9-39) amide?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Peptides Involved in Appetite Modulation Scientific Review

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.