Exendin-3 (9-39) amide

Cat. No. 2081

Exendin-3 (9-39) amide Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2

Price and Availability

For Exendin-3 (9-39) amide pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Potent and selective GLP-1 receptor antagonist (Kd = 1.7 nM at cloned human GLP-1 receptors). Inhibits cAMP production and insulin release induced by GLP-1 (7-36), exendin-3 (IC50 = 20 nM) and exendin-4. Blocks the inhibitory effect of GLP-1 on food intake in rats.

Technical Data

M.Wt:
3369.79
Formula:
C149H234N40O47S
Sequence:
DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

(Modifications: Ser-31 = C-terminal amide)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
133514-43-9

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Data Sheet

Certificate of Analysis / Product Datasheet
Select another batch:

Turton et al (1996) A role for glucagon-like peptide-1 in the central regulation of feeding. Nature 379 69. PMID: 8538742.

Goke et al (1993) Exendin-4 is a high potency agonist and truncated exendin-(9-39)-amide an antagonist at the glucagon-like peptide 1-(7-36)-amide receptor of insulin-secreting β-cells. J.Biol.Chem. 268 19650. PMID: 8396143.

Thorens et al (1993) Cloning and functional expression of the human islet GLP-1 receptor. Demonstration that exendin-4 is an agonist and exendin-(9-39) an antagonist of the receptor. Diabetes 42 1678. PMID: 8405712.

Raufman et al (1991) Exendin-3, a novel peptide from the Heloderma horridum venom, interacts with vasoactive intestinal peptide receptors and a newly described receptor on dispersed acini from guinea pig pancreas. J.Biol.Chem. 266 2897. PMID: 1704369.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products. Selected citations for Exendin-3 (9-39) amide include:

Maniscalco et al (2015) Negative Energy Balance Blocks Neural and Behavioral Responses to Acute Stress by "Silencing" Central Glucagon-Like Peptide 1 Signaling in Rats. Emerg Microbes Infect 35 10701. PMID: 26224855.

Gaitonde et al (2012) The role of the gut hormone GLP-1 in the metabolic improvements caused by ileal transposition. J Surg Res 178 33. PMID: 22929182.

Do you know of a great paper that uses Exendin-3 (9-39) amide from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Exendin-3 (9-39) amide, supplier, Potent, GLP-1, receptor, antagonists, Receptors, Glucagon-Like, Peptide, 1, Tocris Bioscience, Glucagon-Like Peptide 1 Receptor Antagonist products

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs. Request copy or view PDF today.

divider line

Appetite Modulation

Written by S. Tucci et al

Peptides Involved in Appetite Modulation Scientific Review

Our Peptides Involved in Appetite Modulation review gives an overview of the peptides implicated in appetite regulation and energy homeostasis. View PDF today.

divider line

Gut Hormones and the Regulation of Appetite

Written by V.J. Taylor et al

Gut Hormones Life Science Poster

Our Gut Hormones and the Regulation of Appetite poster gives an overview of the neuropeptide modulators and gut hormones that influence appetite. Request copy today.

divider line

New Products in this Area

[Pro3]-GIP (Rat)

High affinity rat GIP receptor partial agonist

Sign-up for new product e-alerts
divider line

LinkedIn Updates

Follow Tocris on LinkedIn

Follow us on LinkedIn!

Visit our LinkedIn page for the latest Tocris news, events and updates.