Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewThymosin β4 is a naturally occuring, potent regulator of actin polymerization present in human platelets at a concentration of 200 - 500 μM. Sequesters G-actin monomers in a 1:1 ratio (Kd = 0.7 - 1.0 μM) and allows rapid filament polymerization in the presence of profilin. Implicated in wound healing, induction of MMPs, chemotaxis, angiogenesis, inflammatory processes and tumor progression.
| M. Wt | 4963.49 |
| Formula | C212H350N56O78S |
| Sequence |
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (Modifications: Ser-1 = N-terminal Ac) |
| Storage | Store at -20°C |
| CAS Number | 77591-33-4 |
| PubChem ID | 90488838 |
| InChI Key | QBEAMNLSDYIUGM-SIQRNXPUSA-N |
| Smiles | CC[C@H](C)[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(C)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
References are publications that support the biological activity of the product.
Yu et al (1993) Thymosin β10 and thymosin β4 are both actin monomer sequestering proteins. J.Biol.Chem. 268 502 PMID: 8416954
Huff et al (2001) β-thymosins, small acidic peptides with multiple functions. Int.J.Biochem.Cell Biol. 33 205 PMID: 11311852
Smart et al (2007) Thymosin β4 and angiogenesis: modes of action and therapeutic potential. Angiogenesis 10 229 PMID: 17632766
Keywords: Thymosin b4, Thymosin b4 supplier, Potent, actin, polymerization, regulator, Thymosin, β4, beta4, Thymosinβ4, Thymosinb4, polymerisation, Actin, 3390, Tocris Bioscience
Citations are publications that use Tocris products.
Currently there are no citations for Thymosin β4.
There are currently no reviews for this product. Be the first to review Thymosin β4 and earn rewards!
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image