Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewPsalmotoxin 1 is a potent and selective acid-sensing ion channel 1a (ASIC1a) blocker (IC50 = 0.9 nM). Displays no effect at ASIC1b, ASIC2a, ASIC3, heteromeric ASIC channels, ENaC and KV2.1/2.2/4.2/4.3 channels expressed in oocytes, at concentrations up to 100 nM. Displays potent analgesic properties against thermal, mechanical, chemical, inflammatory and neuropathic pain in rodents.
| M. Wt | 4689.41 |
| Formula | C200H312N62O57S6 |
| Sequence |
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT (Modifications: Disulfide bridges: 3-18, 10-23, 17-33) |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 316808-68-1 |
| PubChem ID | 90489000 |
| InChI Key | LICLJUGDURFZIM-UHFFFAOYSA-N |
| Smiles | [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC4=CC=CC=C4)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CSSC[C@H](NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]4CCCN4C(=O)[C@@H](NC1=O)[C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N3)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC2=O)C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
| Solubility | Soluble to 2 mg/ml in water |
References are publications that support the biological activity of the product.
Mazzuca et al (2007) A tarantula peptide against pain via ASIC1a channels and opioid mechanisms. Nat.Neurosci. 10 943 PMID: 17632507
Escoubas et al (2000) Isolation of a tarantula toxin specific for a class of proton-gated Na+ channels. J.Biol.Chem. 275 25116 PMID: 10829030
Escoubas et al (2003) Recombinant production and solution structure of PcTx1, the specific peptide inhibitor of ASIC1a proton-gated cation channels. Protein Sci. 12 1332 PMID: 12824480
Salinas et al (2006) The receptor site of the spider toxin PcTx1 on the proton-gated cation channel ASIC1a. J.Physiol. 570 339 PMID: 16284080
If you know of a relevant reference for Psalmotoxin 1, please let us know.
Keywords: Psalmotoxin 1, Psalmotoxin 1 supplier, pctx1, acid-sensing, acid, ion, channel, 1a, ASIC1a, ASIC, blockers, analgesic, pain, thermal, mechanical, chemical, inflammatory, neuropathic, venoms, PcTx1, 5042, Tocris Bioscience
Citations are publications that use Tocris products. Selected citations for Psalmotoxin 1 include:
Shanchun et al (2021) Regulation of gliomagenesis and stemness through acid sensor ASIC1a. Int J Oncol 59 PMID: 34515325
Chih-Cheng et al (2021) ASIC1a is required for neuronal activation via low-intensity ultrasound stimulation in mouse brain. Elife 10 PMID: 34569932
Do you know of a great paper that uses Psalmotoxin 1 from Tocris? Please let us know.
There are currently no reviews for this product. Be the first to review Psalmotoxin 1 and earn rewards!
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image