Pramlintide

Pricing Availability   Qty
Cat.No. 5031 - Pramlintide | KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY(Modifications: Disulfide bridge: 2-7)(Modifications: Tyr-37 = C-terminal amide) | CAS No. 151126-32-8
Description: Synthetic version of amylin (Cat. No. 3418)
Datasheet
Citations
Reviews
Literature

Biological Activity

Synthetic version of amylin (Cat. No. 3418). Exhibits high affinity for amylin, CGRP and calcitonin receptors (Ki values are 0.023, 3.8 and 5.1 nM respectively). Reduces postprandial hyperglycemia; also inhibits gastric emptying.

Technical Data

M. Wt 3949.42
Formula C171H267N51O53S2
Sequence Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2
Storage Store at -20°C
CAS Number 151126-32-8
PubChem ID 70691388
InChI Key TZIRZGBAFTZREM-MKAGXXMWSA-N
Smiles [H]N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC1=O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

All Tocris products are intended for laboratory research use only.

Solubility Data

Solubility Soluble to 1 mg/ml in water

Product Datasheets

Certificate of Analysis / Product Datasheet
Select another batch:

References

References are publications that support the biological activity of the product.

Young et al (1996) Preclinical pharmacology of pramlintide in the rat: comparisons with human and rat amylin. Drug Dev.Res. 37 231

Hoogwerf et al (2008) Pramlintide, the synthetic analogue of amylin: phsyiology, pathophysiology, and effects on glycemic control, body weight, and selected biomarkers of vascular risk. Vasc.Health Risk Manag. 4 355 PMID: 18561511


If you know of a relevant reference for Pramlintide, please let us know.

View Related Products by Product Action

View all Calcitonin and Related Receptor Agonists

Keywords: Pramlintide, Pramlintide supplier, Pramlintide, antidiabetic, amylin, synthetic, calcitonin, CGRP, receptors, Calcitonin, and, Related, Receptors, 5031, Tocris Bioscience

Citations for Pramlintide

Citations are publications that use Tocris products.

Currently there are no citations for Pramlintide. Do you know of a great paper that uses Pramlintide from Tocris? Please let us know.

Reviews for Pramlintide

There are currently no reviews for this product. Be the first to review Pramlintide and earn rewards!

Have you used Pramlintide?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* or download your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


GPCR

GPCR Product Listing

A collection of over 450 products for G protein-coupled receptors, the listing includes research tools for the study of:

  • Rhodopsin-like Receptors
  • Secretin-like Receptors
  • Glutamate Receptors
  • Frizzled Receptors
  • GPCR Signaling
Peptide Hormone Receptors

Peptide Hormone Receptors Product Listing

A collection of over 200 products for peptide hormone receptors, the listing includes research tools for the study of:

  • Anterior Pituitary Regulation
  • Blood Pressure Regulation
  • Feeding and Appetite Regulation
  • Glucose Regulation
  • Peptide Hormone Processing
Peptides Involved in Appetite Modulation

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.