Pramlintide

Pricing Availability Delivery Time Qty
Cat.No. 5031 - Pramlintide | KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY(Modifications: Disulfide bridge: 2-7)(Modifications: Tyr-37 = C-terminal amide) | CAS No. 151126-32-8
Description: Synthetic version of amylin (Cat. No. 3418)
Datasheet
Citations
Literature

Biological Activity

Synthetic version of amylin (Cat. No. 3418). Exhibits high affinity for amylin, CGRP and calcitonin receptors (Ki values are 0.023, 3.8 and 5.1 nM respectively). Reduces postprandial hyperglycemia; also inhibits gastric emptying.

Technical Data

M. Wt 3949.42
Formula C171H267N51O53S2
Sequence Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2
Storage Store at -20°C
CAS Number 151126-32-8
PubChem ID 70691388
InChI Key TZIRZGBAFTZREM-MKAGXXMWSA-N
Smiles [H]N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC1=O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

All Tocris products are intended for laboratory research use only.

Solubility Data

SolubilitySoluble to 1 mg/ml in water

Preparing Stock Solutions

The following data is based on the product molecular weight 3949.42. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.

Select a batch to recalculate based on the batch molecular weight:
Concentration / Solvent Volume / Mass 1 mg 5 mg 10 mg
1 mM 0.25 mL 1.27 mL 2.53 mL
5 mM 0.05 mL 0.25 mL 0.51 mL
10 mM 0.03 mL 0.13 mL 0.25 mL
50 mM 0.01 mL 0.03 mL 0.05 mL

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Dilution Calculator

Calculate the dilution required to prepare a stock solution.
x
=
x

Product Datasheets

Certificate of Analysis / Product Datasheet
Select another batch:
Safety Datasheet

References

References are publications that support the products' biological activity.

Young et al (1996) Preclinical pharmacology of pramlintide in the rat: comparisons with human and rat amylin. Drug Dev.Res. 37 231 PMID:

Hoogwerf et al (2008) Pramlintide, the synthetic analogue of amylin: phsyiology, pathophysiology, and effects on glycemic control, body weight, and selected biomarkers of vascular risk. Vasc.Health Risk Manag. 4 355 PMID: 18561511


If you know of a relevant reference for Pramlintide, please let us know.

View Related Products by Target

View Related Products by Product Action

View all Calcitonin and Related Receptor Agonists

Keywords: Pramlintide, supplier, Pramlintide, antidiabetic, amylin, synthetic, calcitonin, CGRP, receptors, Calcitonin, and, Related, Receptors, Calcitonin, and, Related, Receptors, Tocris Bioscience

Citations for Pramlintide

Citations are publications that use Tocris products.

Currently there are no citations for Pramlintide. Do you know of a great paper that uses Pramlintide from Tocris? If so please let us know.

Commented out for usability testing

Reviews

TODO: Add Reviews

Literature in this Area

GPCR

GPCR Product Listing

A collection of over 450 products for G protein-coupled receptors, the listing includes research tools for the study of:

  • Rhodopsin-like Receptors
  • Secretin-like Receptors
  • Glutamate Receptors
  • Frizzled Receptors
  • GPCR Signaling
Peptide Hormone Receptors

Peptide Hormone Receptors Product Listing

A collection of over 200 products for peptide hormone receptors, the listing includes research tools for the study of:

  • Anterior Pituitary Regulation
  • Blood Pressure Regulation
  • Feeding and Appetite Regulation
  • Glucose Regulation
  • Peptide Hormone Processing
Peptides Involved in Appetite Modulation

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.

Pathways for Pramlintide

Protocols

TODO: Add Protocols