Parathyroid hormone (1-34) (rat)

Pricing Availability Delivery Time Qty
Cat.No. 6301 - Parathyroid hormone (1-34) (rat) | Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe | CAS No. 98614-76-7
Description: Parathyroid hormone (PTH) receptor agonist
Datasheet
Citations
Literature

Biological Activity

Parathyroid hormone (PTH) receptor agonist. Increases serum PTH levels and bone mass in rats.

Technical Data

M. Wt 4057.74
Formula C180H291N55O48S2
Sequence AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF
Storage Store at -20°C
CAS Number 98614-76-7
PubChem ID 16201228
InChI Key QSJWQIQDNBBZSH-NEAXTQLLSA-N
Smiles [H]N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

All Tocris products are intended for laboratory research use only.

Solubility Data

SolubilitySoluble to 1 mg/ml in water

Preparing Stock Solutions

The following data is based on the product molecular weight 4057.74. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.

Concentration / Solvent Volume / Mass 1 mg 5 mg 10 mg
1 mM 0.25 mL 1.23 mL 2.46 mL
5 mM 0.05 mL 0.25 mL 0.49 mL
10 mM 0.02 mL 0.12 mL 0.25 mL
50 mM 0 mL 0.02 mL 0.05 mL

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Dilution Calculator

Calculate the dilution required to prepare a stock solution.
x
=
x

Product Datasheets

Safety Datasheet

References

References are publications that support the products' biological activity.

Lymperi et al (2017) Inhibition of osteoclast function reduces hematopoietic stem cell numbers in vivo. Blood. 117 1540 PMID: 1131587


If you know of a relevant reference for Parathyroid hormone (1-34) (rat), please let us know.

View Related Products by Target

View Related Products by Product Action

View all Parathyroid Hormone Receptor Agonists

Keywords: Parathyroid hormone (1-34) (rat), supplier, Parathyroid, hormone, (1-34), rat, PTH, agonists, agonism, increases, bone, mass, Parathyroid, Hormone, Receptors, Parathyroid, Hormone, Receptors, Tocris Bioscience

Citations for Parathyroid hormone (1-34) (rat)

Citations are publications that use Tocris products.

Currently there are no citations for Parathyroid hormone (1-34) (rat). Do you know of a great paper that uses Parathyroid hormone (1-34) (rat) from Tocris? If so please let us know.

Parathyroid hormone (1-34) (rat) Reviews

Average Rating:

(Based on 0 Reviews)


1 Star
0%
2 Star
0%
3 Star
0%
4 Star
0%
5 Star
0%

Have you used Parathyroid hormone (1-34) (rat)?

Submit a review and receive a $25US/€18/£15/$25CAN Amazon gift card if you include an image -$10US/€7/£6/$10CAN Amazon gift card for reviews without an image. Limited to verified customers in USA, Canada and Europe.


Literature in this Area

GPCR

GPCR Product Listing

A collection of over 450 products for G protein-coupled receptors, the listing includes research tools for the study of:

  • Rhodopsin-like Receptors
  • Secretin-like Receptors
  • Glutamate Receptors
  • Frizzled Receptors
  • GPCR Signaling
Peptide Hormone Receptors

Peptide Hormone Receptors Product Listing

A collection of over 200 products for peptide hormone receptors, the listing includes research tools for the study of:

  • Anterior Pituitary Regulation
  • Blood Pressure Regulation
  • Feeding and Appetite Regulation
  • Glucose Regulation
  • Peptide Hormone Processing