Parathyroid hormone (1-34) (rat)

Pricing Availability   Qty
Cat.No. 6301 - Parathyroid hormone (1-34) (rat) | Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe | CAS No. 98614-76-7
Description: Parathyroid hormone (PTH) receptor agonist
Datasheet
Citations
Reviews
Literature

Biological Activity

Parathyroid hormone (PTH) receptor agonist. Increases serum PTH levels and bone mass in rats.

Technical Data

M. Wt 4057.74
Formula C180H291N55O48S2
Sequence AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF
Storage Store at -20°C
CAS Number 98614-76-7
PubChem ID 16201228
InChI Key QSJWQIQDNBBZSH-NEAXTQLLSA-N
Smiles [H]N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

All Tocris products are intended for laboratory research use only.

Solubility Data

Solubility Soluble to 1 mg/ml in water

References

References are publications that support the biological activity of the product.

Lymperi et al (2017) Inhibition of osteoclast function reduces hematopoietic stem cell numbers in vivo. Blood. 117 1540 PMID: 21131587


If you know of a relevant reference for Parathyroid hormone (1-34) (rat), please let us know.

View Related Products by Product Action

View all Parathyroid Hormone Receptor Agonists

Keywords: Parathyroid hormone (1-34) (rat), Parathyroid hormone (1-34) (rat) supplier, Parathyroid, hormone, (1-34), rat, PTH, agonists, agonism, increases, bone, mass, Hormone, Receptors, 6301, Tocris Bioscience

Citations for Parathyroid hormone (1-34) (rat)

Citations are publications that use Tocris products.

Currently there are no citations for Parathyroid hormone (1-34) (rat). Do you know of a great paper that uses Parathyroid hormone (1-34) (rat) from Tocris? Please let us know.

Reviews for Parathyroid hormone (1-34) (rat)

There are currently no reviews for this product. Be the first to review Parathyroid hormone (1-34) (rat) and earn rewards!

Have you used Parathyroid hormone (1-34) (rat)?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* or download your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


GPCR

GPCR Product Listing

A collection of over 450 products for G protein-coupled receptors, the listing includes research tools for the study of:

  • Rhodopsin-like Receptors
  • Secretin-like Receptors
  • Glutamate Receptors
  • Frizzled Receptors
  • GPCR Signaling
Peptide Hormone Receptors

Peptide Hormone Receptors Product Listing

A collection of over 200 products for peptide hormone receptors, the listing includes research tools for the study of:

  • Anterior Pituitary Regulation
  • Blood Pressure Regulation
  • Feeding and Appetite Regulation
  • Glucose Regulation
  • Peptide Hormone Processing