Parathyroid hormone (1-34) (human)

Pricing Availability Delivery Time Qty
Cat.No. 3011 - Parathyroid hormone (1-34) (human) | Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe | CAS No. 52232-67-4
Description: Parathyroid hormone (PTH) receptor agonist
Alternative Names: PTH 1-34, hPTH (1-34), Teriparatide
Datasheet
Citations
Literature

Biological Activity

Human parathyroid hormone (hPTH) peptide fragment; contains the 34 N-terminal residues of hPTH. Agonist at parathyroid 1 (PTH1) and parathyroid 2 (PTH2) receptors.

Technical Data

M. Wt 4117.75
Formula C181H291N55O51S2
Sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Storage Desiccate at -20°C
CAS Number 52232-67-4
PubChem ID 16132393
InChI Key OGBMKVWORPGQRR-UMXFMPSGSA-N
Smiles [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

All Tocris products are intended for laboratory research use only.

Solubility Data

SolubilitySoluble to 0.40 mg/ml in water

Preparing Stock Solutions

The following data is based on the product molecular weight 4117.75. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.

Concentration / Solvent Volume / Mass 1 mg 5 mg 10 mg
1 mM 0.24 mL 1.21 mL 2.43 mL
5 mM 0.05 mL 0.24 mL 0.49 mL
10 mM 0.02 mL 0.12 mL 0.24 mL
50 mM 0 mL 0.02 mL 0.05 mL

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Dilution Calculator

Calculate the dilution required to prepare a stock solution.
x
=
x

Product Datasheets

Certificate of Analysis / Product Datasheet
Select another batch:
Safety Datasheet

References

References are publications that support the products' biological activity.

Dobnig and Turner (1997) The effects of programmed administration of human parathyroid hormone fragment (1-34) on bone histomorphometry and serum chemistry in rats. Endocrinology 138 4607 PMID: 9348185

Manabe et al (2007) Human parathyroid hormone (1-34) accelerates natural fracture healing process in the femoral osteotomy model of cynomolgus monkeys. Bone 40 1475 PMID: 17369013

Niall et al (1974) The amino acid sequence of the amino-terminal 37 residues of human parathyroid hormone. Proc.Natl.Acad.Sci. 71 384 PMID:


If you know of a relevant reference for Parathyroid hormone (1-34) (human), please let us know.

View Related Products by Target

View Related Products by Product Action

View all Parathyroid Hormone Receptor Agonists

Keywords: Parathyroid hormone (1-34) (human), supplier, Parathyroid, hormone, PTH, receptors, agonists, PTH134, 1-34, teriparatide, PTH, (1-34), hPTH, (1-34), Teriparatide, Parathyroid, Hormone, Receptors, Parathyroid, Hormone, Receptors, Tocris Bioscience

Citations for Parathyroid hormone (1-34) (human)

Citations are publications that use Tocris products.

Currently there are no citations for Parathyroid hormone (1-34) (human). Do you know of a great paper that uses Parathyroid hormone (1-34) (human) from Tocris? If so please let us know.

Parathyroid hormone (1-34) (human) Reviews

Average Rating:

(Based on 0 Reviews)


1 Star
0%
2 Star
0%
3 Star
0%
4 Star
0%
5 Star
0%

Have you used Parathyroid hormone (1-34) (human)?

Submit a review and receive a $25US/€18/£15/$25CAN Amazon gift card if you include an image -$10US/€7/£6/$10CAN Amazon gift card for reviews without an image. Limited to verified customers in USA, Canada and Europe.


Literature in this Area

GPCR

GPCR Product Listing

A collection of over 450 products for G protein-coupled receptors, the listing includes research tools for the study of:

  • Rhodopsin-like Receptors
  • Secretin-like Receptors
  • Glutamate Receptors
  • Frizzled Receptors
  • GPCR Signaling
Peptide Hormone Receptors

Peptide Hormone Receptors Product Listing

A collection of over 200 products for peptide hormone receptors, the listing includes research tools for the study of:

  • Anterior Pituitary Regulation
  • Blood Pressure Regulation
  • Feeding and Appetite Regulation
  • Glucose Regulation
  • Peptide Hormone Processing