Parathyroid hormone (1-34) (bovine)

Discontinued Product

Parathyroid hormone (1-34) (bovine) (Cat. No. 6303) has been withdrawn from sale for commercial reasons.
Cat.No. 6303 - Parathyroid hormone (1-34) (bovine) | AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF | CAS No. 12583-68-5
Description: Parathyroid hormone (PTH) receptor agonist
Literature (2)

Biological Activity for Parathyroid hormone (1-34) (bovine)

Parathyroid hormone (1-34) (bovine) is a parathyroid hormone (PTH) receptor agonist. Increases calcium and inorganic phosphate levels in the serum of young rats. Increases osteocalcin concentrations in the serum of old rats without affecting calcium or phosphate levels.

Technical Data for Parathyroid hormone (1-34) (bovine)

M. Wt 4108.74
Formula C183H288N54O50S2
Sequence Ala-Val-Ser-Glu-Ile-Gln-Phe-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe
Storage Store at -20°C
CAS Number 12583-68-5
PubChem ID 16142419
Smiles [H]N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets for Parathyroid hormone (1-34) (bovine)

References for Parathyroid hormone (1-34) (bovine)

References are publications that support the biological activity of the product.

Mitlak et al (1992) Intermittent administration of bovine PTH-(1-34) increases serum 1,25-dihydroxyvitamin D concentrations and spinal bone density in senile (23 month) rats. J.Bone.Miner.Res. 7 479 PMID: 1615756

View Related Products by Product Action

View all Parathyroid Hormone Receptor Agonists

Keywords: Parathyroid hormone (1-34) (bovine), Parathyroid hormone (1-34) (bovine) supplier, Parathyroid, hormone, (1-34), bovine, agonists, agonism, PTH, osteocalcin, Hormone, Receptors, 6303, Tocris Bioscience

Citations for Parathyroid hormone (1-34) (bovine)

Citations are publications that use Tocris products.

Currently there are no citations for Parathyroid hormone (1-34) (bovine).

Reviews for Parathyroid hormone (1-34) (bovine)

There are currently no reviews for this product. Be the first to review Parathyroid hormone (1-34) (bovine) and earn rewards!

Have you used Parathyroid hormone (1-34) (bovine)?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


GPCR Product Listing

A collection of over 450 products for G protein-coupled receptors, the listing includes research tools for the study of:

  • Rhodopsin-like Receptors
  • Glutamate Receptors
  • Frizzled Receptors
  • GPCR Signaling
Peptide Hormone Receptors

Peptide Hormone Receptors Product Listing

A collection of over 200 products for peptide hormone receptors, the listing includes research tools for the study of:

  • Anterior Pituitary Regulation
  • Blood Pressure Regulation
  • Feeding and Appetite Regulation
  • Glucose Regulation
  • Peptide Hormone Processing