Parathyroid hormone (1-34) (bovine)

Pricing Availability Delivery Time Qty
Cat.No. 6303 - Parathyroid hormone (1-34) (bovine) | AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF | CAS No. 12583-68-5
Description: Parathyroid hormone (PTH) receptor agonist

Biological Activity

Parathyroid hormone (PTH) receptor agonist. Increases calcium and inorganic phosphate levels in the serum of young rats. Increases osteocalcin concentrations in the serum of old rats without affecting calcium or phosphate levels.

Technical Data

M. Wt 4108.74
Formula C183H288N54O50S2
Sequence Ala-Val-Ser-Glu-Ile-Gln-Phe-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe
Storage Store at -20°C
CAS Number 12583-68-5
PubChem ID 16142419
Smiles [H]N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

All Tocris products are intended for laboratory research use only.

Solubility Data

Solubility Soluble to 1 mg/ml in water

Preparing Stock Solutions

The following data is based on the product molecular weight 4108.74. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.

Concentration / Solvent Volume / Mass 1 mg 5 mg 10 mg
1 mM 0.24 mL 1.22 mL 2.43 mL
5 mM 0.05 mL 0.24 mL 0.49 mL
10 mM 0.02 mL 0.12 mL 0.24 mL
50 mM 0 mL 0.02 mL 0.05 mL

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.


Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Product Datasheets

Safety Datasheet


References are publications that support the biological activity of the product.

Mitlak et al (1992) Intermittent administration of bovine PTH-(1-34) increases serum 1,25-dihydroxyvitamin D concentrations and spinal bone density in senile (23 month) rats. J.Bone.Miner.Res. 7 479 PMID: 1615756

If you know of a relevant reference for Parathyroid hormone (1-34) (bovine), please let us know.

View Related Products by Product Action

View all Parathyroid Hormone Receptor Agonists

Keywords: Parathyroid hormone (1-34) (bovine), Parathyroid hormone (1-34) (bovine) supplier, Parathyroid, hormone, (1-34), bovine, agonists, agonism, PTH, osteocalcin, Hormone, Receptors, 6303, Tocris Bioscience

Citations for Parathyroid hormone (1-34) (bovine)

Citations are publications that use Tocris products.

Currently there are no citations for Parathyroid hormone (1-34) (bovine). Do you know of a great paper that uses Parathyroid hormone (1-34) (bovine) from Tocris? Please let us know.

Reviews for Parathyroid hormone (1-34) (bovine)

There are currently no reviews for this product. Be the first to review Parathyroid hormone (1-34) (bovine) and earn rewards!

Have you used Parathyroid hormone (1-34) (bovine)?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* or download your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


GPCR Product Listing

A collection of over 450 products for G protein-coupled receptors, the listing includes research tools for the study of:

  • Rhodopsin-like Receptors
  • Secretin-like Receptors
  • Glutamate Receptors
  • Frizzled Receptors
  • GPCR Signaling
Peptide Hormone Receptors

Peptide Hormone Receptors Product Listing

A collection of over 200 products for peptide hormone receptors, the listing includes research tools for the study of:

  • Anterior Pituitary Regulation
  • Blood Pressure Regulation
  • Feeding and Appetite Regulation
  • Glucose Regulation
  • Peptide Hormone Processing