Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewPACAP 6-38 is a potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)1 antagonist (IC50 = 2 nM). Inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki = 1.5 nM). Antitumor activity in vivo.
M. Wt | 4024.78 |
Formula | C182H300N56O45S |
Sequence |
FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK (Modifications: Lys-33 = C-terminal amide) |
Storage | Store at -20°C |
Purity | ≥95% (HPLC) |
CAS Number | 143748-18-9 |
PubChem ID | 24868185 |
InChI Key | BGZYREVJBMQLGS-ONKNJJKASA-N |
Smiles | [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(N)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility | Soluble to 2 mg/ml in water |
References are publications that support the biological activity of the product.
Robberecht et al (1992) Structural requirements for the occupancy of pituitary adenylate-cyclase-activating-peptide (PACAP) receptors and adenylate cyclase activation in human neuroblastoma NB-OK-1 cell membranes. Discovery of PACAP(6-38) as a potent antagonist. Eur.J.Biochem. 207 239 PMID: 1321043
Leyton et al (1998) PACAP(6-38) inhibits growth of prostate cancer cells. Cancer Lett. 125 131 PMID: 9566707
Kojro et al (2006) The neuropeptide PACAP promotes a-secretase pathway for processing Alzheimer amyloid precursor protein. FASEB J. 20 512 PMID: 16401644
If you know of a relevant reference for PACAP 6-38, please let us know.
Keywords: PACAP 6-38, PACAP 6-38 supplier, Potent, PAC1, receptors, antagonists, Pituitary, Adenylate, Cyclase, Activating, Peptide, PACAP638, PACAP, Receptors, 3236, Tocris Bioscience
Citations are publications that use Tocris products. Selected citations for PACAP 6-38 include:
Maugeri et al (2016) PACAP and VIP Inhibit the Invasiveness of Glioblastoma Cells Exposed to Hypoxia through the Regulation of HIFs and EGFR Expression. Proc Natl Acad Sci U S A 7 139 PMID: 27303300
Do you know of a great paper that uses PACAP 6-38 from Tocris? Please let us know.
There are currently no reviews for this product. Be the first to review PACAP 6-38 and earn rewards!
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image