Metastin (human)

Pricing Availability   Qty
Description: Potent, endogenous ligand for kisspeptin receptor
Alternative Names: Kisspeptin-54, Kp-54
Purity: ≥95% (HPLC)
Datasheet
Citations (1)
Reviews
Literature (1)

Biological Activity for Metastin (human)

Metastin (human) is a potent endogenous ligand of the kisspeptin receptor (KISS1, GPR54). Binds with high affinity to rat and human KISS1 receptors with Ki values of 1.80 and 1.45 nM respectively. Inhibits chemotaxis, invasion and metastasis of human melanomas and breast carcinomas. Stimulates gonadotropin secretion following i.c.v. administration.

Technical Data for Metastin (human)

M. Wt 5857.49
Formula C258H401N79O78
Sequence GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF

(Modifications: Phe-54 = C-terminal amide)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 374683-24-6
PubChem ID 71306396
InChI Key KAHDONZOCXSKII-NJVVDGNHSA-N
Smiles [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=CC=C1)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for Metastin (human)

Solubility Soluble to 1 mg/ml in water

Product Datasheets for Metastin (human)

Certificate of Analysis / Product Datasheet
Select another batch:

References for Metastin (human)

References are publications that support the biological activity of the product.

Gottsch et al (2004) A role for kisspeptins in the regulation of g.tropin secretion in the mouse. Endocrinology 145 4073 PMID: 15217982

Kotani et al (2001) The metastasis suppressor gene KiSS-1 encodes kisspeptins, the natural ligands of the orphan G protein-coupled receptor GPR54. J.Biol.Chem. 276 34631 PMID: 11457843

Ohtaki et al (2001) Metastasis suppressor gene KiSS-1 encodes peptide ligand of a G-protein-coupled receptor. Nature 411 613 PMID: 11385580


If you know of a relevant reference for Metastin (human), please let us know.

View Related Products by Product Action

View all Kisspeptin Receptor Agonists

Keywords: Metastin (human), Metastin (human) supplier, Potent, endogenous, ligand, KISS1, receptors, hOT7T175, AXOR12, GPR54, Metastin, KISS-derived, Peptides, Kisspeptin, Kisspeptin-54, Kp-54, Receptor, 1443, Tocris Bioscience

1 Citation for Metastin (human)

Citations are publications that use Tocris products. Selected citations for Metastin (human) include:

Fayazi et al (2015) The pregnant mouse uterus exhibits a functional kisspeptin/KISS1R signaling system on the day of embryo implantation. Nat Chem Biol 13 105 PMID: 26384646


Do you know of a great paper that uses Metastin (human) from Tocris? Please let us know.

Reviews for Metastin (human)

There are currently no reviews for this product. Be the first to review Metastin (human) and earn rewards!

Have you used Metastin (human)?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Cancer Research Product Guide

Cancer Research Product Guide

A collection of over 750 products for cancer research, the guide includes research tools for the study of:

  • Cancer Metabolism
  • Epigenetics in Cancer
  • Receptor Signaling
  • Cell Cycle and DNA Damage Repair
  • Angiogenesis
  • Invasion and Metastasis