Klotho-derived peptide 1

Pricing Availability   Qty

Save 26% on Select RUO Reagents. See Details

Description: TGF-β receptor 2 (TβR2) binding peptide; disrupts the TGF-β/TβR2 interaction
Purity: ≥95% (HPLC)
Datasheet
Citations
Reviews
Literature (3)
Pathways (1)

Biological Activity for Klotho-derived peptide 1

Klotho-derived peptide 1 (KP1) is a peptide that binds to TGF-β receptor 2 (TβR2) (Kd = 1.4 μM). It inhibits TGF-β signaling by blocking TGF-β/TβR2 interaction. In mouse models of renal fibrosis, intravenous injection of KP1 results in its specific accumulation in the injured kidneys. It suppresses TGF-β signaling, repressing fibroblast activation and ameliorates kidney fibrosis in vivo.

Technical Data for Klotho-derived peptide 1

M. Wt 3228.48
Formula C149H203N39O43
Sequence FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG
Storage Store at -20°C
Purity ≥95% (HPLC)
InChI Key UYTUWBDQBGRXJP-SOZMHADISA-N
Smiles O=C(N[C@@H](CCC(N)=O)C(NCC(N[C@@H]([C@H](O)C)C(N[C@@H](CC1=CC=CC=C1)C(N2[C@@H](CCC2)C(N[C@@H](CC(O)=O)C(NCC(N[C@@H](CC3=CC=CC=C3)C(N[C@@H](CC(C)C)C(N[C@@H](CC4=CNC5=CC=CC=C45)C(N[C@@H](C)C(N[C@@H](C(C)C)C(NCC(N[C@@H](CO)C(N[C@@H](C)C(N[C@@H](C)C(N[C@@H](CC6=CC=C(C=C6)O)C(N[C@@H](CCC(N)=O)C(N[C@@H]([C@H](O)C)C(N[C@@H](CCC(O)=O)C(NCC(NCC(N[C@@H](CC7=CNC8=CC=CC=C78)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCC(N)=O)C(N[C@@H](CC9=CNC=N9)C(NCC(N[C@@H](CCCCN)C(NCC(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC%10=CC=CC=C%10)N

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for Klotho-derived peptide 1

Solubility Soluble to 1 mg/ml in water

Product Datasheets for Klotho-derived peptide 1

Certificate of Analysis / Product Datasheet
Select another batch:

References for Klotho-derived peptide 1

References are publications that support the biological activity of the product.

Yuan et al (2022) A Klotho-derived peptide protects against kidney fibrosis by targeting TGF-β signaling. Nat.Commun. 13 438 PMID: 35064106


If you know of a relevant reference for Klotho-derived peptide 1, please let us know.

Keywords: Klotho-derived peptide 1, Klotho-derived peptide 1 supplier, TGF-βRII, TGF-β, TGF-betaRII, TGFbRII, TGFbR2, Kinases, Transforming, Growth, Factors, Beta, Receptors, TGF-beta, RSTK, Receptor, Serine/Threonine, RSTKs, KP1, renal, fibrosis, kidney, in, vivo, 7830, Tocris Bioscience

Citations for Klotho-derived peptide 1

Citations are publications that use Tocris products.

Currently there are no citations for Klotho-derived peptide 1. Do you know of a great paper that uses Klotho-derived peptide 1 from Tocris? Please let us know.

Reviews for Klotho-derived peptide 1

There are currently no reviews for this product. Be the first to review Klotho-derived peptide 1 and earn rewards!

Have you used Klotho-derived peptide 1?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Stem Cell Research Product Guide

Stem Cell Research Product Guide

This product guide provides a background to the use of small molecules in stem cell research and lists over 200 products for use in:

  • Self-renewal and Maintenance
  • Differentiation
  • Reprogramming
  • Organoid Generation
  • GMP and Ancillary Material Grade Products
Stem Cells Scientific Review

Stem Cells Scientific Review

Written by Kirsty E. Clarke, Victoria B. Christie, Andy Whiting and Stefan A. Przyborski, this review provides an overview of the use of small molecules in the control of stem cell growth and differentiation. Key signaling pathways are highlighted, and the regulation of ES cell self-renewal and somatic cell reprogramming is discussed. Compounds available from Tocris are listed.

Stem Cells Poster

Stem Cells Poster

Written by Rebecca Quelch and Stefan Przyborski from Durham University (UK), this poster describes the isolation of pluripotent stem cells, their maintenance in culture, differentiation, and the generation and potential uses of organoids.

Pathways for Klotho-derived peptide 1

TGF-β Signaling Pathway

TGF-β Signaling Pathway

The TGF-β signaling pathway is involved in the regulation of growth and proliferation of cells along with migration, differentiation and apoptosis.