Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewKlotho-derived peptide 1 (KP1) is a peptide that binds to TGF-β receptor 2 (TβR2) (Kd = 1.4 μM). It inhibits TGF-β signaling by blocking TGF-β/TβR2 interaction. In mouse models of renal fibrosis, intravenous injection of KP1 results in its specific accumulation in the injured kidneys. It suppresses TGF-β signaling, repressing fibroblast activation and ameliorates kidney fibrosis in vivo.
| M. Wt | 3228.48 |
| Formula | C149H203N39O43 |
| Sequence | FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| InChI Key | UYTUWBDQBGRXJP-SOZMHADISA-N |
| Smiles | O=C(N[C@@H](CCC(N)=O)C(NCC(N[C@@H]([C@H](O)C)C(N[C@@H](CC1=CC=CC=C1)C(N2[C@@H](CCC2)C(N[C@@H](CC(O)=O)C(NCC(N[C@@H](CC3=CC=CC=C3)C(N[C@@H](CC(C)C)C(N[C@@H](CC4=CNC5=CC=CC=C45)C(N[C@@H](C)C(N[C@@H](C(C)C)C(NCC(N[C@@H](CO)C(N[C@@H](C)C(N[C@@H](C)C(N[C@@H](CC6=CC=C(C=C6)O)C(N[C@@H](CCC(N)=O)C(N[C@@H]([C@H](O)C)C(N[C@@H](CCC(O)=O)C(NCC(NCC(N[C@@H](CC7=CNC8=CC=CC=C78)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCC(N)=O)C(N[C@@H](CC9=CNC=N9)C(NCC(N[C@@H](CCCCN)C(NCC(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC%10=CC=CC=C%10)N |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
| Solubility | Soluble to 1 mg/ml in water |
References are publications that support the biological activity of the product.
Yuan et al (2022) A Klotho-derived peptide protects against kidney fibrosis by targeting TGF-β signaling. Nat.Commun. 13 438 PMID: 35064106
If you know of a relevant reference for Klotho-derived peptide 1, please let us know.
Keywords: Klotho-derived peptide 1, Klotho-derived peptide 1 supplier, TGF-βRII, TGF-β, TGF-betaRII, TGFbRII, TGFbR2, Kinases, Transforming, Growth, Factors, Beta, Receptors, TGF-beta, RSTK, Receptor, Serine/Threonine, RSTKs, KP1, renal, fibrosis, kidney, in, vivo, 7830, Tocris Bioscience
Citations are publications that use Tocris products.
Currently there are no citations for Klotho-derived peptide 1. Do you know of a great paper that uses Klotho-derived peptide 1 from Tocris? Please let us know.
There are currently no reviews for this product. Be the first to review Klotho-derived peptide 1 and earn rewards!
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Written by Kirsty E. Clarke, Victoria B. Christie, Andy Whiting and Stefan A. Przyborski, this review provides an overview of the use of small molecules in the control of stem cell growth and differentiation. Key signaling pathways are highlighted, and the regulation of ES cell self-renewal and somatic cell reprogramming is discussed. Compounds available from Tocris are listed.