Glucagon-like peptide 1 (1-37) (human, rat)

Pricing Availability   Qty

Save 15% on Select RUO Reagents. See Details. 

Description: Endogenous pancreatic peptide
Alternative Names: GLP-1 (1-37) amide
Purity: ≥95% (HPLC)
Datasheet
Citations (1)
Reviews
Literature (1)

Biological Activity

Glucagon-like peptide 1 (1-37) (human, rat) is a pancreatic hormone synthesized by post-translational processing of proglucagon. Unlike truncated forms of GLP-1, it has no effect on food intake in rats and does not enhance pancreatic insulin secretion. However it induces insulin expression in intestinal epithelial cells, which can restore glucose homeostasis when implanted into diabetic mice.

Technical Data

M. Wt 4169.52
Formula C186H275N51O59
Sequence HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 87805-34-3
PubChem ID 16131070
InChI Key UKVFVQPAANCXIL-FJVFSOETSA-N
Smiles [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data

Solubility Soluble to 5 mg/ml in water

Product Datasheets

Certificate of Analysis / Product Datasheet
Select another batch:

References

References are publications that support the biological activity of the product.

Bell et al (1983) Exon duplication and divergence in the human preproglucagon gene. Nature 304 368 PMID: 6877358

Navarro et al (1996) Colocalization of glucagon-like peptide-1 (GLP-1) receptors, glucose transporter GLUT-2, and glucokinase mRNAs in rat hypothalamic cells: evidence for a role of GLP-1 receptor agonists as an inhibitory signal for food and water intake. J.Neurochem. 67 1982 PMID: 8863504

Suzuki et al (2003) Glucagon-like peptide 1 (1-37) converts intestinal epithelial cells into Ins-producing cells. Proc.Natl.Acad.Sci.USA 100 5034


If you know of a relevant reference for Glucagon-like peptide 1 (1-37) (human, rat), please let us know.

View Related Products by Product Action

View all Glucagon-Like Peptide 1 Receptor Agonists

Keywords: Glucagon-like peptide 1 (1-37) (human, rat), Glucagon-like peptide 1 (1-37) (human, rat) supplier, Endogenous, pancreatic, peptide, GLP1, Receptors, Glucagon-Like, Peptide, 1, Glucagon-like, peptide1, (1-37), (human, rat), GLP1(1-37), amide, diabetes, GLP-1, 1851, Tocris Bioscience

1 Citation for Glucagon-like peptide 1 (1-37) (human, rat)

Citations are publications that use Tocris products. Selected citations for Glucagon-like peptide 1 (1-37) (human, rat) include:

Zhang et al (2013) The slow afterhyperpolarization: a target of β1-adrenergic signaling in hippocampus-dependent memory retrieval. J Neurosci 33 5006 PMID: 23486971


Do you know of a great paper that uses Glucagon-like peptide 1 (1-37) (human, rat) from Tocris? Please let us know.

Reviews for Glucagon-like peptide 1 (1-37) (human, rat)

There are currently no reviews for this product. Be the first to review Glucagon-like peptide 1 (1-37) (human, rat) and earn rewards!

Have you used Glucagon-like peptide 1 (1-37) (human, rat)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Peptides Involved in Appetite Modulation Scientific Review

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.