Galanin (1-30) (human)

Pricing Availability Delivery Time Qty
Cat.No. 1179 - Galanin (1-30) (human) | Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser | CAS No. 119418-04-1
Description: Endogenous galanin receptor agonist
Datasheet
Citations (2)
Reviews
Literature

Biological Activity

Endogenous peptide with multiple endocrine, metabolic and behavioral effects. Has been shown to have an action on intestinal smooth muscle, insulin and somatostatin release, and synaptic neurotransmission.

Technical Data

M. Wt 3157.41
Formula C139H210N42O43
Sequence GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Storage Desiccate at -20°C
CAS Number 119418-04-1
PubChem ID 16133823
InChI Key CBSXZYWGVAQSHI-RUKUCZSXSA-N
Smiles [H]NCC(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

All Tocris products are intended for laboratory research use only.

Solubility Data

Solubility Soluble to 0.50 mg/ml in water

Preparing Stock Solutions

The following data is based on the product molecular weight 3157.41. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.

Concentration / Solvent Volume / Mass 1 mg 5 mg 10 mg
1 mM 0.32 mL 1.58 mL 3.17 mL
5 mM 0.06 mL 0.32 mL 0.63 mL
10 mM 0.03 mL 0.16 mL 0.32 mL
50 mM 0.01 mL 0.03 mL 0.06 mL

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Dilution Calculator

Calculate the dilution required to prepare a stock solution.
x
=
x

Product Datasheets

Certificate of Analysis / Product Datasheet
Select another batch:
Safety Datasheet

References

References are publications that support the biological activity of the product.

Niiro et al (1998) Mechanisms of galanin-induced contraction in the rat myometrium. Br.J.Pharmacol. 124 1623 PMID: 9756377

Schmidt et al (1991) Isolation and primary structure of pituitary human galanin, a 30-residue nonamidated neuropeptide. Proc.Natl.Acad.Sci.U.S.A. 88 11435 PMID: 1722333

Wang et al (1998) Hypothalamic galanin: control by signals of fat metabolism. Brain Res. 804 7 PMID: 9729239


If you know of a relevant reference for Galanin (1-30) (human), please let us know.

View Related Products by Product Action

View all Galanin Receptor Agonists

Keywords: Galanin (1-30) (human), Galanin (1-30) (human) supplier, Endogenous, galanin, agonists, GAL, GalR, Receptors, Galanin, 1179, Tocris Bioscience

2 Citations for Galanin (1-30) (human)

Citations are publications that use Tocris products. Selected citations for Galanin (1-30) (human) include:

Camp et al (2016) Dynamic mass redistribution reveals diverging importance of PDZ-ligands for G protein-coupled receptor pharmacodynamics. Pharmacol Res 105 13 PMID: 26773201

Chiu et al (2013) Bacteria activate sensory neurons that modulate pain and inflammation. Nature 501 52 PMID: 23965627


Do you know of a great paper that uses Galanin (1-30) (human) from Tocris? Please let us know.

Reviews for Galanin (1-30) (human)

There are currently no reviews for this product. Be the first to review Galanin (1-30) (human) and earn rewards!

Have you used Galanin (1-30) (human)?

Submit a review and receive an Amazon gift card.

$10US/$10CAN/€7/£6 gift card for a review without an image

$25US/$25CAN/€18/£15 gift card for a review with an image

*Offer only valid in the USA / Canada, UK and Europe

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* or download your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


GPCR

GPCR Product Listing

A collection of over 450 products for G protein-coupled receptors, the listing includes research tools for the study of:

  • Rhodopsin-like Receptors
  • Secretin-like Receptors
  • Glutamate Receptors
  • Frizzled Receptors
  • GPCR Signaling
Peptide Hormone Receptors

Peptide Hormone Receptors Product Listing

A collection of over 200 products for peptide hormone receptors, the listing includes research tools for the study of:

  • Anterior Pituitary Regulation
  • Blood Pressure Regulation
  • Feeding and Appetite Regulation
  • Glucose Regulation
  • Peptide Hormone Processing
Peptides Involved in Appetite Modulation

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.