Galanin (1-30) (human)

Pricing Availability   Qty
Description: Endogenous galanin receptor agonist
Purity: ≥95% (HPLC)
Datasheet
Citations (2)
Reviews
Literature (1)

Biological Activity for Galanin (1-30) (human)

Galanin (1-30) (human) is a endogenous peptide with multiple endocrine, metabolic and behavioral effects. Has been shown to have an action on intestinal smooth muscle, insulin and somatostatin release, and synaptic neurotransmission.

Technical Data for Galanin (1-30) (human)

M. Wt 3157.41
Formula C139H210N42O43
Sequence GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 119418-04-1
PubChem ID 16133823
InChI Key CBSXZYWGVAQSHI-RUKUCZSXSA-N
Smiles [H]NCC(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for Galanin (1-30) (human)

Solubility Soluble to 0.50 mg/ml in water

Product Datasheets for Galanin (1-30) (human)

Certificate of Analysis / Product Datasheet
Select another batch:

References for Galanin (1-30) (human)

References are publications that support the biological activity of the product.

Niiro et al (1998) Mechanisms of galanin-induced contraction in the rat myometrium. Br.J.Pharmacol. 124 1623 PMID: 9756377

Schmidt et al (1991) Isolation and primary structure of pituitary human galanin, a 30-residue nonamidated neuropeptide. Proc.Natl.Acad.Sci.U.S.A. 88 11435 PMID: 1722333

Wang et al (1998) Hypothalamic galanin: control by signals of fat metabolism. Brain Res. 804 7 PMID: 9729239


If you know of a relevant reference for Galanin (1-30) (human), please let us know.

View Related Products by Product Action

View all Galanin Receptor Agonists

Keywords: Galanin (1-30) (human), Galanin (1-30) (human) supplier, Endogenous, galanin, agonists, GAL, GalR, Receptors, Galanin, 1179, Tocris Bioscience

2 Citations for Galanin (1-30) (human)

Citations are publications that use Tocris products. Selected citations for Galanin (1-30) (human) include:

Camp et al (2016) Dynamic mass redistribution reveals diverging importance of PDZ-ligands for G protein-coupled receptor pharmacodynamics. Pharmacol Res 105 13 PMID: 26773201

Chiu et al (2013) Bacteria activate sensory neurons that modulate pain and inflammation. Nature 501 52 PMID: 23965627


Do you know of a great paper that uses Galanin (1-30) (human) from Tocris? Please let us know.

Reviews for Galanin (1-30) (human)

There are currently no reviews for this product. Be the first to review Galanin (1-30) (human) and earn rewards!

Have you used Galanin (1-30) (human)?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Peptides Involved in Appetite Modulation Scientific Review

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.