Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewCalcitonin (human) is an endogenous calcitonin receptor agonist. Lowers systemic blood calcium levels and inhibits bone resorption.
| M. Wt | 3417.87 |
| Formula | C151H226N40O45S3 |
| Sequence |
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP (Modifications: Pro-32 = C-terminal amide, Disulfide bridge: 1-7) |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 21215-62-3 |
| PubChem ID | 122705992 |
| InChI Key | LCQDOKHKNORMTQ-JKQNMTHDSA-N |
| Smiles | [H]N[C@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)CNC1=O)[C@@H](C)O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
| Solubility | Soluble to 2 mg/ml in water |
References are publications that support the biological activity of the product.
Foster (1968) Calcitonin. A review of experimental and clinical investigations. Postgrad.Med.J. 44 411 PMID: 4871775
Bower and Hay (2016) Amylin structure-function relationships and receptor pharmacology: implications for amylin mimetic drug development. Br.J.Pharmacol. 173 1883 PMID: 27061187
Lee et al (2016) Calcitonin and amylin receptor peptide interaction mechanisms. J.Biol.Chem. 291 16416 PMID: 27474777
If you know of a relevant reference for Calcitonin (human), please let us know.
Keywords: Calcitonin (human), Calcitonin (human) supplier, endogenous, calcitonin, receptors, agonists, agonism, inhibits, bone, resorption, Calcitonin, and, Related, Receptors, 6031, Tocris Bioscience
Citations are publications that use Tocris products.
Currently there are no citations for Calcitonin (human). Do you know of a great paper that uses Calcitonin (human) from Tocris? Please let us know.
There are currently no reviews for this product. Be the first to review Calcitonin (human) and earn rewards!
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.