Calcitonin (human)

Pricing Availability Delivery Time Qty
Cat.No. 6031 - Calcitonin (human) | Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 | CAS No. 21215-62-3
Description: Endogenous calcitonin receptor agonist; inhibits bone resorption
Datasheet
Citations
Literature

Biological Activity

Endogenous calcitonin receptor agonist. Lowers systemic blood calcium levels and inhibits bone resorption.

Technical Data

M. Wt 3417.87
Formula C151H226N40O45S3
Sequence CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP

(Modifications: Pro-32 = C-terminal amide, Disulfide bridge between 1 - 7)

Storage Store at -20°C
CAS Number 21215-62-3
PubChem ID 122705992
InChI Key LCQDOKHKNORMTQ-JKQNMTHDSA-N
Smiles [H]N[C@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)CNC1=O)[C@@H](C)O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

All Tocris products are intended for laboratory research use only.

Solubility Data

SolubilitySoluble to 2 mg/ml in water

Preparing Stock Solutions

The following data is based on the product molecular weight 3417.87. Batch specific molecular weights may vary from batch to batch due to solvent of hydration, which will affect the solvent volumes required to prepare stock solutions.

Select a batch to recalculate based on the batch molecular weight:
Concentration / Solvent Volume / Mass 1 mg 5 mg 10 mg
1 mM 0.29 mL 1.46 mL 2.93 mL
5 mM 0.06 mL 0.29 mL 0.59 mL
10 mM 0.03 mL 0.15 mL 0.29 mL
50 mM 0.01 mL 0.03 mL 0.06 mL

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Dilution Calculator

Calculate the dilution required to prepare a stock solution.
x
=
x

Product Datasheets

Safety Datasheet

References

References are publications that support the products' biological activity.

Foster (1968) Calcitonin. A review of experimental and clinical investigations. Postgrad.Med.J. 44 411 PMID: 4871775

Bower and Hay (2016) Amylin structure-function relationships and receptor pharmacology: implications for amylin mimetic drug development. Br.J.Pharmacol. 173 1883 PMID: 27061187

Lee et al (2016) Calcitonin and amylin receptor peptide interaction mechanisms. J.Biol.Chem. 291 16416 PMID: 27474777


If you know of a relevant reference for Calcitonin (human), please let us know.

View Related Products by Target

View Related Products by Product Action

View all Calcitonin and Related Receptor Agonists

Keywords: endogenous calcitonin receptors agonists agonism inhibits bone resorption Calcitonin and Related Receptors

Citations for Calcitonin (human)

Citations are publications that use Tocris products.

Currently there are no citations for Calcitonin (human). Do you know of a great paper that uses Calcitonin (human) from Tocris? If so please let us know.

Commented out for usability testing

Reviews

TODO: Add Reviews

Literature in this Area

GPCR

GPCR Product Listing

A collection of over 450 products for G protein-coupled receptors, the listing includes research tools for the study of:

  • Rhodopsin-like Receptors
  • Secretin-like Receptors
  • Glutamate Receptors
  • Frizzled Receptors
  • GPCR Signaling
Peptide Hormone Receptors

Peptide Hormone Receptors Product Listing

A collection of over 200 products for peptide hormone receptors, the listing includes research tools for the study of:

  • Anterior Pituitary Regulation
  • Blood Pressure Regulation
  • Feeding and Appetite Regulation
  • Glucose Regulation
  • Peptide Hormone Processing
Peptides Involved in Appetite Modulation

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.

Pathways for Calcitonin (human)

Protocols

TODO: Add Protocols