Brain natriuretic peptide (1-32) (human)

Pricing Availability   Qty
Description: Endogenous peptide agonist at ANP receptor A (NPR1)
Purity: ≥95% (HPLC)
Datasheet
Citations (1)
Reviews (1)

Biological Activity

Brain natriuretic peptide (1-32) (human) is an endogenous peptide secreted from cardiac ventricles in response to volume increase and pressure overload that acts as an agonist at atrial natriuretic peptide (ANP) receptor A (NRP1). Decreases de novo collagen synthesis and increases MMP gene expression in vitro. Exhibits natriuretic, vasodilatory and lusitropic activity and inhibits the sympathetic and renin-angiotensin-aldosterone systems in vivo.

Technical Data

M. Wt 3464.05
Formula C143H244N50O42S4
Sequence SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

(Modification: Disulfide bridge: 10-26)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 124584-08-3
PubChem ID 53325981
InChI Key HPNRHPKXQZSDFX-OAQDCNSJSA-N
Smiles [H]N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@H]1CSSC[C@H](NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)CNC(=O)[C@H](CC2=CC=CC=C2)NC1=O)[C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data

Solubility Soluble in water

Product Datasheets

Certificate of Analysis / Product Datasheet
Select another batch:

References

References are publications that support the biological activity of the product.

Tsuruda et al (2002) Brain natriuretic peptide is produced in cardiac fibroblasts and induces matrix metalloproteinases. Circ.Res. 91 1127 PMID: 12480813

Wellard et al (2006) Natriuretic peptides, but not nitric oxide donors, elevate levels of cytosolic guanosine 3',5'-cyclic monophosphate in ependymal cells ex vivo. Neurosci.Lett. 392 187 PMID: 16278044

Heublein et al (2007) Immunoreactivity and guanosine 3',5'-cyclic monophosphate activating actions of various forms of human B-type natriuretic peptide. Hypertension 49 1114 PMID: 17372040


If you know of a relevant reference for Brain natriuretic peptide (1-32) (human), please let us know.

View Related Products by Product Action

View all Natriuretic Peptide Receptor Agonists

Keywords: Brain natriuretic peptide (1-32) (human), Brain natriuretic peptide (1-32) (human) supplier, Endogenous, peptide, agonists, ANP, receptor, A, NRP1, Receptors, Atrial, Natriuretic, Peptide, Receptor, 3522, Tocris Bioscience

1 Citation for Brain natriuretic peptide (1-32) (human)

Citations are publications that use Tocris products. Selected citations for Brain natriuretic peptide (1-32) (human) include:

Wang et al (2017) GDF15 is a heart-derived hormone that regulates body growth. EMBO Mol Med 9 1150 PMID: 28572090


Do you know of a great paper that uses Brain natriuretic peptide (1-32) (human) from Tocris? Please let us know.

Reviews for Brain natriuretic peptide (1-32) (human)

Average Rating: 5 (Based on 1 Review.)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%

Have you used Brain natriuretic peptide (1-32) (human)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Filter by:


NP in vitro.
By Anonymous on 08/05/2018
Assay Type: In Vitro
Species: Human

Used in vitro to investigate different roles of NP family members.