Apelin-36 (human)

Pricing Availability   Qty

Save 26% on Select RUO Reagents. See Details

Description: Endogenous apelin agonist
Purity: ≥95% (HPLC)
Datasheet
Citations
Reviews

Biological Activity for Apelin-36 (human)

Apelin-36 (human) is an endogenous APJ receptor agonist (EC50 = 20 nM) that is secreted by adipocytes. Binds with high affinity to human APJ receptors expressed in HEK 293 cells (pIC50= 8.61). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ.

Technical Data for Apelin-36 (human)

M. Wt 4195.87
Formula C184H297N69O43S
Sequence LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 252642-12-9
PubChem ID 25023576
InChI Key IRSHPNNQNFBJMK-ZWVJBCNTSA-N
Smiles [H]N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N1CCC[C@H]1C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for Apelin-36 (human)

Solubility Soluble to 1 mg/ml in water

Product Datasheets for Apelin-36 (human)

Certificate of Analysis / Product Datasheet
Select another batch:

References for Apelin-36 (human)

References are publications that support the biological activity of the product.

Zou et al (2000) Apelin peptides block the entry of human immunodeficiency virus (HIV). FEBS Lett. 473 15 PMID: 10802050

Medhurst et al (2003) Pharmacological and immunohistochemical characterization of the APJ receptor and its endogenous ligand apelin. J.Neurochem. 84 1162 PMID: 12603839

Tatemoto et al (1998) Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor. Biochem.Biophys.Res.Comm. 251 471


If you know of a relevant reference for Apelin-36 (human), please let us know.

View Related Products by Product Action

View all Apelin Receptor Agonists

Keywords: Apelin-36 (human), Apelin-36 (human) supplier, Endogenous, APJ, receptors, agonists, Apelin, adipokines, Receptors, 2426, Tocris Bioscience

Citations for Apelin-36 (human)

Citations are publications that use Tocris products.

Currently there are no citations for Apelin-36 (human). Do you know of a great paper that uses Apelin-36 (human) from Tocris? Please let us know.

Reviews for Apelin-36 (human)

There are currently no reviews for this product. Be the first to review Apelin-36 (human) and earn rewards!

Have you used Apelin-36 (human)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review